SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|229583334|ref|YP_002841733.1| from Sulfolobus islandicus Y.N.15.51

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|229583334|ref|YP_002841733.1|
Domain Number 1 Region: 5-241
Classification Level Classification E-value
Superfamily Acyl-CoA dehydrogenase NM domain-like 3.4e-72
Family Medium chain acyl-CoA dehydrogenase, NM (N-terminal and middle) domains 0.00036
Further Details:      
 
Domain Number 2 Region: 228-367
Classification Level Classification E-value
Superfamily Acyl-CoA dehydrogenase C-terminal domain-like 4.03e-18
Family Medium chain acyl-CoA dehydrogenase-like, C-terminal domain 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|229583334|ref|YP_002841733.1|
Sequence length 370
Comment acyl-CoA dehydrogenase [Sulfolobus islandicus Y.N.15.51]
Sequence
MSKNEDELEEYRSKIREWIRNNVPEEISSKGDMAPPEILREWQRRIYEAGYLGVSWPKEY
GGWGENPIKEIIVREEFAKAGVPYATVGLGVSVVGPAIILNGTEEQKKKYIRRILTAEDI
WCQGFSEPQAGSDLAGIKTKAEDKGDHFLVNGQKIWSSYAHLANYCLLLTRTGDVSERHK
GLTMLVVDMKSEGIRISPIKQITGRSEFNTLYFSNVKVPKENVVGNVGEGWKVAMSTLNY
ERLNIGTILFTVERLVRELSINNEQLFNTAEDIVALKSFYKRVLERLKKGYVAGPEAAVI
KLVASEAIQRVYENAVANAGIEGLVMENGAGFRPEIIYGLLASRAITIAGGTSEILRNLL
GEVVLGLPKG
Download sequence
Identical sequences C3MKV7 C3N9D5 C3NN04 D2PFD1
gi|284996707|ref|YP_003418474.1| gi|227829348|ref|YP_002831127.1| WP_012712920.1.13477 WP_012712920.1.34992 WP_012712920.1.52267 WP_012712920.1.66823 gi|229583334|ref|YP_002841733.1| 419942.YN1551_2910 429572.LS215_0330 439386.YG5714_0306 gi|229578121|ref|YP_002836519.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]