SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|229583380|ref|YP_002841779.1| from Sulfolobus islandicus Y.N.15.51

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|229583380|ref|YP_002841779.1|
Domain Number 1 Region: 4-234
Classification Level Classification E-value
Superfamily Purine and uridine phosphorylases 1.44e-69
Family Purine and uridine phosphorylases 0.00000000197
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|229583380|ref|YP_002841779.1|
Sequence length 236
Comment purine or other phosphorylase family 1 [Sulfolobus islandicus Y.N.15.51]
Sequence
MNPVHILAKKGEVAERVLIAGDPGRVRLLSLLLESPRLVNENRGFLVYTGKYNGETVSIA
THGIGGPSIAIVLEELAMLGAKVFIRYGTTGALVPYINLGEYIIVTGASYNQGGLFYQYL
RDNVCVASTPDFELTNKLLTSFSKKGLKYYVGNVFSSDAFYAEDEEFVKRWSSRGNIAVE
MECATLFMLSKIKGWKSATVLVVSDNLAKGGVWISKEDLEKSVMEGARAVLDSLTS
Download sequence
Identical sequences C3MMI7 C3NBW4 C3NN50 D2PHT4
gi|227831569|ref|YP_002833349.1| WP_012714567.1.13477 WP_012714567.1.34992 WP_012714567.1.52267 WP_012714567.1.66823 gi|284999121|ref|YP_003420889.1| 419942.YN1551_2969 429572.LS215_2770 439386.YG5714_2779 gi|229583380|ref|YP_002841779.1| gi|229580521|ref|YP_002838921.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]