SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|229583410|ref|YP_002841809.1| from Sulfolobus islandicus Y.N.15.51

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|229583410|ref|YP_002841809.1|
Domain Number 1 Region: 184-427
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.78e-82
Family Leukotriene A4 hydrolase catalytic domain 0.001
Further Details:      
 
Domain Number 2 Region: 8-171
Classification Level Classification E-value
Superfamily Leukotriene A4 hydrolase N-terminal domain 2.09e-39
Family Leukotriene A4 hydrolase N-terminal domain 0.0012
Further Details:      
 
Weak hits

Sequence:  gi|229583410|ref|YP_002841809.1|
Domain Number - Region: 529-756
Classification Level Classification E-value
Superfamily ARM repeat 0.0269
Family GUN4-associated domain 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|229583410|ref|YP_002841809.1|
Sequence length 784
Comment peptidase M1 membrane alanine aminopeptidase [Sulfolobus islandicus Y.N.15.51]
Sequence
MHNVEKYEIFLDFNGYDYEGIEKIYLTSNEEKLELDSLDLEIESVKSDGREVKFEVKGEK
LIIYDKVERELEVRFKGKASRDSILGIYVAPYNGKGMITTQFEAIYARRFIPCFDHPAMK
ARFRLSVRVEKGLKVISNMPVEKIEEDANGKVIYHFQETPRMSTYLLYLGIDDFEEIADD
SKRPTIILATVPGKSMRGLFAINVGRKVIEFYEKYFEIPYQLPKVHLIQVPEFAAGAMEN
WGAITFRETALLADDSSSVYQKFRVAEVVAHELAHQWFGNLVTLKWWDDLWLNESFATFM
SFKSLKYLFPQWDSEGHLIYGETLSALEDDSLTTTHPIETHVRDPHEIEQMFDNISYGKG
ASILRMIEAYVGEENFRRGVVNYLNSFKFGNAEGKDLWDSISKAVGQDIGEIMADWITKP
GYPVIFVNTYGNSVRFSQKRFMLLDSELNETYKVPLTYEINGKFSTLLLDKEFTEIRLEE
GLKSIKVNVNRTGFYRVLYDSLDLAFSSKHNVYEELGLVNDYWNFLLADLIDSRMYFDLL
SRFTNTSNSFVSREITSQLLTLFYLFKKHYGKDFLVNQVKIFRKFNDDLGKLAYSAIINA
LATTDEEFALGLSTLFDQYENIDSNMKEAVAIAYAITTNDFNTLLEKYKKYTIDEEKNRM
LSAISSLRDPSIVNKVFSLIFNRTIKTQDTRFVISSLVHNPHIREEVCEYLINNFDEVKK
FINTVYGGPWGLGSIVRSMSFCGVDKPREIIDFLEKVKFKEIERPIKESEERIKIYSRLK
KKMP
Download sequence
Identical sequences C3NFF3
WP_012718192.1.52267 gi|229583410|ref|YP_002841809.1| 419942.YN1551_3000

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]