SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|229583421|ref|YP_002841820.1| from Sulfolobus islandicus Y.N.15.51

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|229583421|ref|YP_002841820.1|
Domain Number 1 Region: 151-417
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 7.34e-78
Family D-glucarate dehydratase-like 0.0000166
Further Details:      
 
Domain Number 2 Region: 48-168
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 9.58e-24
Family Enolase N-terminal domain-like 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|229583421|ref|YP_002841820.1|
Sequence length 438
Comment mandelate racemase/muconate lactonizing protein [Sulfolobus islandicus Y.N.15.51]
Sequence
MKITSIRPIANITIETAKIVLLLIQYIPYFLADKNFIFSKPLLTYMTKISEIEAYILGKE
ITSAQWASLMILVKVTTSDGRVGWGETVSALRAEAVANFVKKINTVLKGSDVFNVEKNKL
EWYKHDFNMTISLESTTAYSAVDIASWDVIGKEWGAPLYKLLGGKTRDKILVYANGWYQN
CVMPEDFADKAKEVVKKGYKALKFDPFGPYFNDISKRGLDMAEERVKAVREAVGDNVDIL
IEHHGRFNANSAIMIAKKLEKYNPLFMEEPVHPEDMEGLKKYRANTSLRIALGERIINKH
QALHFMKEGLVDFLQADLYRIGGVTETKKVVGIAEVFDVLMAFHNAQGPILNAATLQFDA
FIPNFLIQESFYDWFPSWKRELIYDGTPVDNGYAIIPERPGLGVEVNEKVLESLKVKGEE
YFNPEEPVWVVKGTWKNY
Download sequence
Identical sequences C3NFG4
gi|229583421|ref|YP_002841820.1| 419942.YN1551_3011

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]