SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|229583448|ref|YP_002841847.1| from Sulfolobus islandicus Y.N.15.51

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|229583448|ref|YP_002841847.1|
Domain Number 1 Region: 3-172
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 3.43e-50
Family CO dehydrogenase flavoprotein N-terminal domain-like 0.0000429
Further Details:      
 
Domain Number 2 Region: 177-281
Classification Level Classification E-value
Superfamily CO dehydrogenase flavoprotein C-terminal domain-like 3.92e-29
Family CO dehydrogenase flavoprotein C-terminal domain-like 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|229583448|ref|YP_002841847.1|
Sequence length 282
Comment molybdopterin dehydrogenase FAD-binding [Sulfolobus islandicus Y.N.15.51]
Sequence
MYPPDFTYVRVSSTEEATKFLESHEDARPLAGGQSLIPMLKLRVISPNYIVDLNPVTSLS
YVRSSYNSTRIGALTRYNEILKNDLVKVNVPLLHQAVKVVGDMQVRNLGTIGGSAANADP
SADMPTVLTALNAEIVLLSASGNRSVNALDFFKGAFTTDLRKGEIISEIVLPNLEGYRTI
YKKIVRRAGDFALVSLALAIKLRQNEIEDIRLAYGGVGERPFRALEVEKSVTSKRLNDEL
IEEIVSKVSSQVNPPSDTRGSSWYRRELMKVITRKALKEVLS
Download sequence
Identical sequences C3MMQ5 C3NCG4 C3NFJ1
gi|229580592|ref|YP_002838992.1| gi|229583448|ref|YP_002841847.1| 419942.YN1551_3038 429572.LS215_2837 439386.YG5714_2851 gi|227831637|ref|YP_002833417.1| WP_012714622.1.13477 WP_012714622.1.52267 WP_012714622.1.66823

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]