SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|229582135|ref|YP_002840534.1| from Sulfolobus islandicus Y.N.15.51

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|229582135|ref|YP_002840534.1|
Domain Number 1 Region: 3-312
Classification Level Classification E-value
Superfamily FMN-binding split barrel 5.49e-90
Family UbiD middle domain-like 0.00000346
Further Details:      
 
Domain Number 2 Region: 313-474
Classification Level Classification E-value
Superfamily UbiD C-terminal domain-like 2.09e-55
Family UbiD C-terminal domain-like 0.0000362
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|229582135|ref|YP_002840534.1|
Sequence length 481
Comment UbiD family decarboxylase [Sulfolobus islandicus Y.N.15.51]
Sequence
MAFKDLRDYIEFMKKRNKLIEVDEEVSVDLEITEITRKATYAHLPPLLFKRIKNYENWKI
ISNIFYSIESFYEILGTNKLESISEGFLSNLSNMPITFFDKIKSLREILGLGKVMPKAKT
PSFKEEKNLDLAKIPAIKTWPKDAGRYLTFSITITKDPETDVHNLSVYRIQILNEKEAII
HWQAFKRGALTAKRYLEKGTTKIPIAIVTGVDPAIAFTAASPVPHGIDKYMFAGILRGEG
VDVTELDDKLLVPSHSEVVLTGYVDLNDMRLEGPFGDHMGYYTPADYYPVFKLEKVYIRE
DPIFHVTSVGKPPLEDAWIGKAVERIFLPFAKMLVPELVDMNLPEYGLFTGIGIFSIKKY
YPGQAKRVMMALWGTGQLSLLKTIIIVDQDIDVHDINQVIYAIAANVDPKRDVWVIENAL
TDSLDPSVQFPPLGSKLGIDATRKFKEEMGKEWPEEVRSDEGVAKKADEIINKIIKRYQT
S
Download sequence
Identical sequences C3NHK2
419942.YN1551_1524 WP_012717482.1.52267 gi|229582135|ref|YP_002840534.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]