SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|229917597|ref|YP_002886243.1| from Exiguobacterium sp. AT1b

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|229917597|ref|YP_002886243.1|
Domain Number 1 Region: 289-508
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.16e-41
Family ABC transporter ATPase domain-like 0.00015
Further Details:      
 
Domain Number 2 Region: 21-285
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 3.53e-24
Family DNA repair protein MutS, domain III 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|229917597|ref|YP_002886243.1|
Sequence length 638
Comment DNA mismatch repair protein MutS domain-containing protein [Exiguobacterium sp. AT1b]
Sequence
MNEQTFEKLQYNELMMKVERFCISGFGRRLLRQQRPTSHMATVKKRLQETSEARAILDAT
SHVPFIGVSDMETIIGKLQRGIQLEATELEAVAEFLRGARKLKRFMLEHEFFAPLLSAYA
AGMGEWRTLEEDITQAIRAGQVVDEASKELKRIRKQVDILEGRIEERLTKFLKSAANREM
IQDGFVTKKQDRFTIPIKASYKHKVAGTIVDTSNRGTTVFIEPEAIAKLNAELVVKRTEE
AVEVYQVLATLTGAVTEVLPDIESTLDVIAQYDMVFAKGKYSQSIDGVTPHVNVSGRIRL
KQVRHPLLESAVPLDFAIGTDYRGLIITGPNAGGKTVVLKTIGLLSLMTMTGLHIPAHTD
TVISTFDEVFVDIGDNQDLESALSTFSAHMYNVANIMQTAGKRSLLLFDEIGSGTEPNEG
AALAIAILEAAYKRGAIVVASTHYGEIKSYSEAHPDFMNAAMQFDPETLEPKYRLLMGQS
GDSNALFIARKMKLPESILKQASRYMNEKTYDMTKVDDSKITREVEMVPLEEAEHFEKGD
RVRLLETNQVGLVYSFDASRRHVRVFVDAEYVELPSRRVRLEARATELYPADYDLDTLFT
TYQERKEAHDFARGSKKALRRVEKEIRERKKQEQSNRK
Download sequence
Identical sequences C4L0D5
360911.EAT1b_1872 WP_015880357.1.32866 gi|229917597|ref|YP_002886243.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]