SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|229918122|ref|YP_002886768.1| from Exiguobacterium sp. AT1b

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|229918122|ref|YP_002886768.1|
Domain Number 1 Region: 1-101
Classification Level Classification E-value
Superfamily Hypothetical protein YfhH 5.75e-35
Family Hypothetical protein YfhH 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|229918122|ref|YP_002886768.1|
Sequence length 104
Comment hypothetical protein EAT1b_2402 [Exiguobacterium sp. AT1b]
Sequence
MEKRLSDLSKYELEQEIQALHERKRKAEQMGMVSEIEVVLRRIAIAESYLIDPSSFRPGE
TYVVNYNDRPFRLKFVNGVMGWGTFEGEMTERAIPLSELSEVKR
Download sequence
Identical sequences C4L349
360911.EAT1b_2402 gi|229918122|ref|YP_002886768.1| WP_015880882.1.1636 WP_015880882.1.22157 WP_015880882.1.32866 WP_015880882.1.48863 WP_015880882.1.75483

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]