SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|229916988|ref|YP_002885634.1| from Exiguobacterium sp. AT1b

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|229916988|ref|YP_002885634.1|
Domain Number 1 Region: 362-381,457-665
Classification Level Classification E-value
Superfamily HAD-like 1.83e-58
Family Meta-cation ATPase, catalytic domain P 0.00021
Further Details:      
 
Domain Number 2 Region: 166-263
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 1.7e-26
Family Calcium ATPase, transduction domain A 0.003
Further Details:      
 
Domain Number 3 Region: 101-167,264-355
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.00000000000000366
Family Calcium ATPase, transmembrane domain M 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|229916988|ref|YP_002885634.1|
Sequence length 670
Comment copper-translocating P-type ATPase [Exiguobacterium sp. AT1b]
Sequence
MMEHAHGQHHGHHEESHESHHGGHGHEHMIDDFKRRFFISLGLMIPILLLSDMIQEWLRF
ELDFPLEKTILFVLATIVYVYGGWPFLKGSVEELRERSPGMMMLIGLAISVAYFYSAAVV
FGYGSGHDFFWELASLIVIMLLGHWIEMRSVMGASNALEQLVQLLPNEAHRINGEETEDV
PISELKEGDRILVKPGEQVPVDGKIIKGRTTIDESMLTGESVPVEKTEGEDVIAGSINQE
GSLTIETIGTGESTYLSKVIELVSEAQKSKSRAQNLANRAAKYLFYIAIAAGVITFTIWF
MLGYSVGTAVERMVTVMVISCPHALGLATPLVVAVSTALSAKQGLLIRNRTQFEEARRLD
AVIFDKTGTLTEGNFGVTDVQASSSYTEEDVLQLAGAVERESQHPLAQGILREAERRELK
LSAVDDFGSMTGIGLEGTVDGAHVQVVSPRHIRDQHIQIDQETFARLSGEGKTVVFVLKD
GGWVGMIAMADLVREEAKDTVEALHEKGIRSIMLTGDNEKVAHWVARQLGIDDVYAEVLP
DDKANQVKDIQKDGSKVAMVGDGINDAPALAQADVGIAIGSGTDVAVETADIVLVRSNPK
DVLSILDLSQNTYRKMIQNLWWAAGYNIVAIPLAAGVLAPIGIILSPAVGAVLMSLSTVI
VAINARLLKI
Download sequence
Identical sequences C4KYM6
360911.EAT1b_1262 gi|229916988|ref|YP_002885634.1| WP_012727308.1.32866

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]