SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|254804545|ref|YP_003082766.1| from Neisseria meningitidis alpha14

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|254804545|ref|YP_003082766.1|
Domain Number 1 Region: 279-411
Classification Level Classification E-value
Superfamily Cell-division protein ZipA, C-terminal domain 2.75e-24
Family Cell-division protein ZipA, C-terminal domain 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|254804545|ref|YP_003082766.1|
Sequence length 428
Comment hypothetical protein NMO_0552 [Neisseria meningitidis alpha14]
Sequence
MIYIVLFLAAVLAVVAYNMYQENQYRKKVRDQFGHSDKDALLNSKTSHVRDGKPSGGSVM
MPKPQPAVKKTAKPQDPAMRNLQEQDAVYIAKQKQAKASPFKTEIETALEESGIIGNSAH
TVSEPQTGHSAPKPADAPAKPAPVPQTPAKPLITLKELSKVELPWFDVRFDFISYIALTE
AKELHALPRLSNRCRYQIVGCTMDDHFQIAEPIPGIRYQAFIVGIQAVSRNGLASQEELS
AFNRQVDAFAQSMGGQTLHTDLAAFIEVASALDAFCARVDQTIAIHLVSPTSISGVELRS
AVTGVGFVLEDDGAFHYTDTSGSTMFSICSLNNEPFTNALLDNQSYKGFSMLLDIPHSPA
GEKTFDDLFMDLAVRLSGQLNLNLVNDKMEEVSTQWLKDVRTYVLARQSEMLKVGIEPGG
KTALRLFS
Download sequence
Identical sequences A0A0Y5USX8 C6S5T2
gi|254804545|ref|YP_003082766.1| gi|385854813|ref|YP_005901326.1| WP_002237663.1.17027 WP_002237663.1.32549 WP_002237663.1.33363 WP_002237663.1.42093 WP_002237663.1.46523 WP_002237663.1.48085 WP_002237663.1.54031 WP_002237663.1.54577 WP_002237663.1.62826 WP_002237663.1.71155 WP_002237663.1.7399 WP_002237663.1.78231 WP_002237663.1.81942 WP_002237663.1.82858 WP_002237663.1.84492 WP_002237663.1.86562 WP_002237663.1.90543 WP_002237663.1.97018 WP_002237663.1.98994 662598.NMO_0552

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]