SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|254804978|ref|YP_003083199.1| from Neisseria meningitidis alpha14

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|254804978|ref|YP_003083199.1|
Domain Number 1 Region: 152-352
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 4.84e-53
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0000000836
Further Details:      
 
Domain Number 2 Region: 436-568
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 7.85e-32
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00000069
Further Details:      
 
Domain Number 3 Region: 16-147
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 6.05e-26
Family Duplicated SiR/NiR-like domains 1 and 3 0.00028
Further Details:      
 
Domain Number 4 Region: 354-430
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 3.43e-20
Family Duplicated SiR/NiR-like domains 1 and 3 0.0000651
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|254804978|ref|YP_003083199.1|
Sequence length 589
Comment sulfite reductase subunit beta [Neisseria meningitidis alpha14]
Sequence
MTVQTKTKGLAWQEKPLSDNERLKTESNFLRGTILDDLKDPLTGGFKGDNFQLIRFHGMY
EQDDRDIRAERAEAKLEPLKFMLLRCRLPGGIIKPSQWIELDKFARENSHYRSIRLTNRQ
TFQFHGVPKAKLQTMHRLLHKLGLDSIATAADMNRNVLCTSNPIESELHRQAYEYAKKIS
EHLLPRTRGYLDVWVDGKKVQSSDDFLQEDEPILGKTYLPRKFKTAVVIPPLNDVDCYGN
DLDFVAISDGNGQLAGFNVLAGGGLSMEHGNTKTYPNISLELGFVPPEHALKAAEAVVTT
QRDFGNRSDRKNARTRYTIQNMGLDNFRAEVERRMGMPFEPIRPFKFTGRGDRIGWVKGI
DGNWHLTLFIESGRLVDEGGKQLLTGVLEIAKIHKGDFRITANQNLIVANVPERGKARIE
QLARSYGLIHDGVSKLRENAMSCVSFPTCPLAMAEAERVLPDFIDDLDKIMAKHGTSDDY
IVTRITGCPNGCGRAMLAEIGLVGKAVGRYNLHIGGDREGVRIPRLYKENITLPEILAEL
DDLIGKWAAERNIGEGFGDFAIRTGIVKPVLDAPVDFWDASKAVPIARA
Download sequence
Identical sequences C6S716
WP_015815580.1.82858 gi|254804978|ref|YP_003083199.1| 662598.NMO_1007

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]