SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|229579815|ref|YP_002838214.1| from Sulfolobus islandicus Y.G.57.14

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|229579815|ref|YP_002838214.1|
Domain Number 1 Region: 218-375
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 5.36e-16
Family Hypothetical protein aq 1666 0.0058
Further Details:      
 
Weak hits

Sequence:  gi|229579815|ref|YP_002838214.1|
Domain Number - Region: 19-108
Classification Level Classification E-value
Superfamily LigT-like 0.000413
Family tRNA splicing product Appr>p cyclic nucleotide phosphodiesterase 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|229579815|ref|YP_002838214.1|
Sequence length 386
Comment metallophosphoesterase [Sulfolobus islandicus Y.G.57.14]
Sequence
MRNSYIIEIRPILEKYKLKQIMRKIRSISYLKVHRVPHITLVYNFRPLVAPLKIMEVIKE
VSNRYGNLEFYYDKYEIKNGKEGYTIALGIRPNNELLQFREDLYKSLKNYIKERSDAKFY
NENFWFHAGISFHLSCKVVKNISNNKEMLQILSRFLYEAKVLRITLVNTGKIVYEYDILN
KKILNRAEALSLVELEKTYEKYREKYLKIEVNPKSLDKIWFIADTHFGHKNIIKYSARPF
VDVTTMNEHIKNKWNEMISNDDIVYIVGDFARRDFKNYVNFLNGKKIFIQGNHDPPAIGV
KQLELQLNNYKFILSHYPTNLNSYNAWLIHGHVHNNRLRKYPFINSKIKTINVGVDVTKF
YPVNLKWILNLIETKSDYLYLPPKII
Download sequence
Identical sequences C3N805 C3NFA8
gi|229579815|ref|YP_002838214.1| 419942.YN1551_0884 439386.YG5714_2038 WP_012716448.1.13477 WP_012716448.1.52267 gi|229581527|ref|YP_002839926.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]