SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|253775570|ref|YP_003038401.1| from Escherichia coli 'BL21-Gold(DE3)pLysS AG'

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|253775570|ref|YP_003038401.1|
Domain Number 1 Region: 1-105
Classification Level Classification E-value
Superfamily Frataxin/Nqo15-like 9.77e-41
Family Frataxin-like 0.000000599
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|253775570|ref|YP_003038401.1|
Sequence length 106
Comment frataxin-like protein [Escherichia coli 'BL21-Gold(DE3)pLysS AG']
Sequence
MNDSEFHRLADQLWLTIEERLDDWDGDSDIDCEINGGVLTITFENGSKIIINRQEPLHQV
WLATKQGGYHFDMKGDEWICDRSGETFWDLLEQAATQQAGETVSFR
Download sequence
Identical sequences A0A0A1AH02 A0A140NFM4 A0A142H8N9 A0A170WK35 B1LLX7 D3H414 L4IUV8 T9ARN5 V0SQV8 V0XTF2 W1BBA2
gi|251787064|ref|YP_003001368.1| gi|170681576|ref|YP_001746123.1| gi|253775570|ref|YP_003038401.1| gi|254163748|ref|YP_003046856.1| gi|251787064|ref|YP_003001368.1| gi|387609610|ref|YP_006098466.1| WP_000999950.1.100916 WP_000999950.1.101110 WP_000999950.1.10131 WP_000999950.1.101439 WP_000999950.1.101727 WP_000999950.1.1058 WP_000999950.1.10605 WP_000999950.1.10809 WP_000999950.1.11265 WP_000999950.1.11467 WP_000999950.1.12060 WP_000999950.1.12174 WP_000999950.1.12230 WP_000999950.1.12459 WP_000999950.1.12675 WP_000999950.1.12679 WP_000999950.1.13002 WP_000999950.1.13409 WP_000999950.1.13672 WP_000999950.1.14322 WP_000999950.1.14946 WP_000999950.1.1550 WP_000999950.1.15990 WP_000999950.1.16010 WP_000999950.1.16843 WP_000999950.1.16979 WP_000999950.1.17061 WP_000999950.1.17360 WP_000999950.1.17496 WP_000999950.1.18588 WP_000999950.1.19374 WP_000999950.1.19649 WP_000999950.1.20170 WP_000999950.1.21017 WP_000999950.1.21450 WP_000999950.1.22280 WP_000999950.1.22431 WP_000999950.1.23330 WP_000999950.1.23724 WP_000999950.1.23869 WP_000999950.1.23985 WP_000999950.1.24088 WP_000999950.1.24316 WP_000999950.1.24577 WP_000999950.1.24592 WP_000999950.1.25312 WP_000999950.1.2597 WP_000999950.1.26196 WP_000999950.1.27098 WP_000999950.1.27188 WP_000999950.1.27611 WP_000999950.1.28145 WP_000999950.1.28314 WP_000999950.1.29049 WP_000999950.1.29164 WP_000999950.1.29394 WP_000999950.1.29603 WP_000999950.1.30397 WP_000999950.1.30783 WP_000999950.1.30808 WP_000999950.1.31029 WP_000999950.1.31506 WP_000999950.1.3201 WP_000999950.1.32480 WP_000999950.1.32772 WP_000999950.1.35632 WP_000999950.1.35704 WP_000999950.1.36699 WP_000999950.1.36739 WP_000999950.1.36904 WP_000999950.1.3796 WP_000999950.1.38155 WP_000999950.1.38185 WP_000999950.1.38782 WP_000999950.1.39167 WP_000999950.1.39575 WP_000999950.1.39796 WP_000999950.1.40 WP_000999950.1.40842 WP_000999950.1.4158 WP_000999950.1.41960 WP_000999950.1.41991 WP_000999950.1.43216 WP_000999950.1.44422 WP_000999950.1.44784 WP_000999950.1.45674 WP_000999950.1.46573 WP_000999950.1.46991 WP_000999950.1.46994 WP_000999950.1.47167 WP_000999950.1.47500 WP_000999950.1.47764 WP_000999950.1.48090 WP_000999950.1.48847 WP_000999950.1.50947 WP_000999950.1.51380 WP_000999950.1.51548 WP_000999950.1.5158 WP_000999950.1.51690 WP_000999950.1.51881 WP_000999950.1.52137 WP_000999950.1.52313 WP_000999950.1.52421 WP_000999950.1.53693 WP_000999950.1.54104 WP_000999950.1.54476 WP_000999950.1.54993 WP_000999950.1.55275 WP_000999950.1.55472 WP_000999950.1.55563 WP_000999950.1.56197 WP_000999950.1.562 WP_000999950.1.56285 WP_000999950.1.57438 WP_000999950.1.58444 WP_000999950.1.59263 WP_000999950.1.59912 WP_000999950.1.60048 WP_000999950.1.60411 WP_000999950.1.61360 WP_000999950.1.62322 WP_000999950.1.65366 WP_000999950.1.65749 WP_000999950.1.66016 WP_000999950.1.66280 WP_000999950.1.66667 WP_000999950.1.6706 WP_000999950.1.67200 WP_000999950.1.67758 WP_000999950.1.6793 WP_000999950.1.68070 WP_000999950.1.68071 WP_000999950.1.68138 WP_000999950.1.69160 WP_000999950.1.6921 WP_000999950.1.69341 WP_000999950.1.6945 WP_000999950.1.71632 WP_000999950.1.72208 WP_000999950.1.72857 WP_000999950.1.72893 WP_000999950.1.73061 WP_000999950.1.74367 WP_000999950.1.74549 WP_000999950.1.74574 WP_000999950.1.74880 WP_000999950.1.76948 WP_000999950.1.77290 WP_000999950.1.77419 WP_000999950.1.77950 WP_000999950.1.78202 WP_000999950.1.78368 WP_000999950.1.78791 WP_000999950.1.79306 WP_000999950.1.79389 WP_000999950.1.7952 WP_000999950.1.79640 WP_000999950.1.80343 WP_000999950.1.8068 WP_000999950.1.81156 WP_000999950.1.81267 WP_000999950.1.81576 WP_000999950.1.81624 WP_000999950.1.8295 WP_000999950.1.8345 WP_000999950.1.8384 WP_000999950.1.84877 WP_000999950.1.86227 WP_000999950.1.86234 WP_000999950.1.87491 WP_000999950.1.88467 WP_000999950.1.88711 WP_000999950.1.89551 WP_000999950.1.89899 WP_000999950.1.89977 WP_000999950.1.91626 WP_000999950.1.9199 WP_000999950.1.92096 WP_000999950.1.92305 WP_000999950.1.92638 WP_000999950.1.93939 WP_000999950.1.93971 WP_000999950.1.94367 WP_000999950.1.94436 WP_000999950.1.94739 WP_000999950.1.94934 WP_000999950.1.95861 WP_000999950.1.96059 WP_000999950.1.96279 WP_000999950.1.96650 WP_000999950.1.96695 WP_000999950.1.9723 WP_000999950.1.97269 WP_000999950.1.97379 WP_000999950.1.98000 WP_000999950.1.98429 WP_000999950.1.99349 413997.ECB_03682 439855.EcSMS35_4172 469008.ECBD_4235

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]