SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|407471052|ref|YP_006782505.1| from Escherichia coli O104:H4 str. 2009EL-2071

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|407471052|ref|YP_006782505.1|
Domain Number 1 Region: 1-362
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 1.24e-109
Family FMN-linked oxidoreductases 0.0000000000109
Further Details:      
 
Domain Number 2 Region: 333-519
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 1.06e-41
Family N-terminal domain of adrenodoxin reductase-like 0.00000032
Further Details:      
 
Domain Number 3 Region: 467-627
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.67e-27
Family C-terminal domain of adrenodoxin reductase-like 0.0000000672
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|407471052|ref|YP_006782505.1|
Sequence length 672
Comment 2,4-dienoyl-CoA reductase [Escherichia coli O104:H4 str. 2009EL-2071]
Sequence
MSYPSLFAPLDLGFTTLKNRVLMGSMHTGLEEYPDGAERLAAFYAERARHGVALIVSGGI
APDLTGVGMEGGAMLNDASQIPHHRTITEAVHQEGGKIALQILHTGRYSYQPHLVAPSAL
QAPINRFVPHELTHEEILQLIDDFAHCAQLAREAGYDGVEVMGSEGYLINEFLTLRTNQR
SDQWGGDYRNRMRFAVEVVRTVRERVGNDFIIIYRLSMLDLVEGGGTFAETVELAQAIEA
AGATIINTGIGWHEARIPTIATPVPRGAFTWVTRKLKGHVSLPLVTTNRINDPQVADDIL
SRGDADMVSMARPFLADAELLSKAQSGRADEINTCIGCNQACLDQIFVGKVTSCLVNPRA
CHETKMPILPAVQKKNLAVVGAGPAGLAFAINAAARGHQVTLFDAHSEIGGQFNIAKQIP
GKEEFYETLRYYHRMIEVTGVTLKLNHTVTADQLQAFDETILASGIVPRVPPIDGIDHPK
VLSYLDVLRDKAPVGNKVAIIGCGGIGFDTAMYLSQPGESTSQNIARFCNEWGIDSSLQQ
AGGLSPQGMQIPRSPRQIVMLQRKASKPGQGLGKTTGWIHRTTLLSRGVKMIPGVSYQKI
DDDGLHVVINGETQVLAVDNVVICAGQEPNRALAQPLIDSGKTVHLIGGCDVAMELDARR
AIAQGTRLALEI
Download sequence
Identical sequences A0A073FQ47 A0A080FPJ6 A0A0A8KKM0 A0A0E0XVH2 A0A0E2TXT3 A0A1S6TFU0 A0A222QQW2 B7LH13 F4VJ80
gi|218696785|ref|YP_002404452.1| gi|407480291|ref|YP_006777440.1| gi|410480851|ref|YP_006768397.1| WP_000121472.1.1000 WP_000121472.1.100346 WP_000121472.1.100499 WP_000121472.1.100689 WP_000121472.1.100718 WP_000121472.1.10080 WP_000121472.1.101359 WP_000121472.1.101418 WP_000121472.1.101518 WP_000121472.1.101845 WP_000121472.1.101969 WP_000121472.1.101987 WP_000121472.1.10673 WP_000121472.1.10994 WP_000121472.1.12344 WP_000121472.1.13656 WP_000121472.1.14070 WP_000121472.1.14199 WP_000121472.1.14398 WP_000121472.1.14508 WP_000121472.1.15041 WP_000121472.1.15221 WP_000121472.1.15583 WP_000121472.1.16014 WP_000121472.1.16183 WP_000121472.1.16387 WP_000121472.1.17102 WP_000121472.1.17170 WP_000121472.1.17172 WP_000121472.1.17182 WP_000121472.1.17241 WP_000121472.1.17550 WP_000121472.1.17766 WP_000121472.1.17920 WP_000121472.1.18064 WP_000121472.1.18164 WP_000121472.1.18530 WP_000121472.1.18650 WP_000121472.1.18666 WP_000121472.1.18899 WP_000121472.1.18983 WP_000121472.1.1909 WP_000121472.1.19147 WP_000121472.1.19581 WP_000121472.1.19778 WP_000121472.1.20159 WP_000121472.1.20549 WP_000121472.1.21336 WP_000121472.1.21628 WP_000121472.1.21945 WP_000121472.1.22269 WP_000121472.1.22494 WP_000121472.1.22908 WP_000121472.1.23376 WP_000121472.1.23393 WP_000121472.1.23463 WP_000121472.1.24575 WP_000121472.1.24641 WP_000121472.1.25050 WP_000121472.1.25086 WP_000121472.1.2558 WP_000121472.1.26270 WP_000121472.1.2637 WP_000121472.1.2642 WP_000121472.1.26479 WP_000121472.1.26613 WP_000121472.1.26720 WP_000121472.1.27060 WP_000121472.1.27580 WP_000121472.1.27856 WP_000121472.1.28109 WP_000121472.1.28250 WP_000121472.1.28480 WP_000121472.1.28523 WP_000121472.1.28683 WP_000121472.1.29118 WP_000121472.1.2952 WP_000121472.1.30123 WP_000121472.1.31803 WP_000121472.1.31924 WP_000121472.1.3193 WP_000121472.1.32138 WP_000121472.1.32234 WP_000121472.1.32494 WP_000121472.1.32561 WP_000121472.1.32724 WP_000121472.1.32875 WP_000121472.1.32946 WP_000121472.1.32972 WP_000121472.1.33341 WP_000121472.1.34094 WP_000121472.1.35202 WP_000121472.1.35465 WP_000121472.1.36042 WP_000121472.1.36094 WP_000121472.1.36507 WP_000121472.1.36812 WP_000121472.1.36925 WP_000121472.1.36975 WP_000121472.1.37099 WP_000121472.1.37352 WP_000121472.1.37371 WP_000121472.1.37538 WP_000121472.1.37758 WP_000121472.1.37852 WP_000121472.1.37880 WP_000121472.1.38357 WP_000121472.1.38811 WP_000121472.1.38935 WP_000121472.1.39302 WP_000121472.1.39481 WP_000121472.1.39509 WP_000121472.1.39690 WP_000121472.1.4020 WP_000121472.1.40686 WP_000121472.1.41239 WP_000121472.1.41371 WP_000121472.1.41402 WP_000121472.1.41654 WP_000121472.1.41752 WP_000121472.1.42415 WP_000121472.1.43137 WP_000121472.1.43177 WP_000121472.1.43239 WP_000121472.1.43455 WP_000121472.1.44029 WP_000121472.1.44273 WP_000121472.1.4449 WP_000121472.1.44524 WP_000121472.1.44661 WP_000121472.1.44857 WP_000121472.1.4570 WP_000121472.1.46239 WP_000121472.1.4646 WP_000121472.1.46526 WP_000121472.1.46552 WP_000121472.1.4657 WP_000121472.1.46616 WP_000121472.1.46743 WP_000121472.1.46990 WP_000121472.1.46999 WP_000121472.1.47028 WP_000121472.1.47029 WP_000121472.1.47050 WP_000121472.1.47363 WP_000121472.1.47425 WP_000121472.1.47790 WP_000121472.1.4796 WP_000121472.1.48018 WP_000121472.1.48188 WP_000121472.1.48222 WP_000121472.1.48385 WP_000121472.1.48421 WP_000121472.1.4857 WP_000121472.1.48678 WP_000121472.1.49124 WP_000121472.1.49774 WP_000121472.1.49861 WP_000121472.1.49954 WP_000121472.1.50418 WP_000121472.1.50586 WP_000121472.1.50616 WP_000121472.1.50725 WP_000121472.1.50969 WP_000121472.1.51058 WP_000121472.1.51109 WP_000121472.1.51580 WP_000121472.1.51629 WP_000121472.1.51718 WP_000121472.1.52378 WP_000121472.1.5239 WP_000121472.1.52691 WP_000121472.1.52881 WP_000121472.1.52913 WP_000121472.1.52962 WP_000121472.1.532 WP_000121472.1.53242 WP_000121472.1.53356 WP_000121472.1.53364 WP_000121472.1.5342 WP_000121472.1.53966 WP_000121472.1.54023 WP_000121472.1.54817 WP_000121472.1.55197 WP_000121472.1.55417 WP_000121472.1.55597 WP_000121472.1.5561 WP_000121472.1.55787 WP_000121472.1.56149 WP_000121472.1.56689 WP_000121472.1.56742 WP_000121472.1.57072 WP_000121472.1.57086 WP_000121472.1.57281 WP_000121472.1.57638 WP_000121472.1.58001 WP_000121472.1.58267 WP_000121472.1.58507 WP_000121472.1.58705 WP_000121472.1.59174 WP_000121472.1.59409 WP_000121472.1.59699 WP_000121472.1.60325 WP_000121472.1.60436 WP_000121472.1.60491 WP_000121472.1.61174 WP_000121472.1.61806 WP_000121472.1.61939 WP_000121472.1.62714 WP_000121472.1.62762 WP_000121472.1.62959 WP_000121472.1.63374 WP_000121472.1.63556 WP_000121472.1.64707 WP_000121472.1.65306 WP_000121472.1.654 WP_000121472.1.65408 WP_000121472.1.66001 WP_000121472.1.66644 WP_000121472.1.6676 WP_000121472.1.66849 WP_000121472.1.67209 WP_000121472.1.67383 WP_000121472.1.67522 WP_000121472.1.67581 WP_000121472.1.67701 WP_000121472.1.67724 WP_000121472.1.6802 WP_000121472.1.69098 WP_000121472.1.69472 WP_000121472.1.69649 WP_000121472.1.69972 WP_000121472.1.70063 WP_000121472.1.70357 WP_000121472.1.71109 WP_000121472.1.71147 WP_000121472.1.71339 WP_000121472.1.72021 WP_000121472.1.72240 WP_000121472.1.7225 WP_000121472.1.72608 WP_000121472.1.72751 WP_000121472.1.73249 WP_000121472.1.73257 WP_000121472.1.73259 WP_000121472.1.73908 WP_000121472.1.74156 WP_000121472.1.74501 WP_000121472.1.74532 WP_000121472.1.74689 WP_000121472.1.74735 WP_000121472.1.74852 WP_000121472.1.75021 WP_000121472.1.75181 WP_000121472.1.75360 WP_000121472.1.76656 WP_000121472.1.77162 WP_000121472.1.77462 WP_000121472.1.7781 WP_000121472.1.78445 WP_000121472.1.7883 WP_000121472.1.78888 WP_000121472.1.78919 WP_000121472.1.7898 WP_000121472.1.79067 WP_000121472.1.79346 WP_000121472.1.79540 WP_000121472.1.79591 WP_000121472.1.80112 WP_000121472.1.80737 WP_000121472.1.81026 WP_000121472.1.81165 WP_000121472.1.81475 WP_000121472.1.82217 WP_000121472.1.82239 WP_000121472.1.8277 WP_000121472.1.82799 WP_000121472.1.83035 WP_000121472.1.8306 WP_000121472.1.84060 WP_000121472.1.84894 WP_000121472.1.85525 WP_000121472.1.85657 WP_000121472.1.86210 WP_000121472.1.86266 WP_000121472.1.86283 WP_000121472.1.86355 WP_000121472.1.86364 WP_000121472.1.86371 WP_000121472.1.86376 WP_000121472.1.86454 WP_000121472.1.86492 WP_000121472.1.86617 WP_000121472.1.86640 WP_000121472.1.8711 WP_000121472.1.87189 WP_000121472.1.87249 WP_000121472.1.87568 WP_000121472.1.87607 WP_000121472.1.87788 WP_000121472.1.87789 WP_000121472.1.88149 WP_000121472.1.88376 WP_000121472.1.89492 WP_000121472.1.9009 WP_000121472.1.90706 WP_000121472.1.90813 WP_000121472.1.90834 WP_000121472.1.90890 WP_000121472.1.91290 WP_000121472.1.91511 WP_000121472.1.9157 WP_000121472.1.91596 WP_000121472.1.92102 WP_000121472.1.92215 WP_000121472.1.93379 WP_000121472.1.93951 WP_000121472.1.94353 WP_000121472.1.94808 WP_000121472.1.94822 WP_000121472.1.9491 WP_000121472.1.95244 WP_000121472.1.9559 WP_000121472.1.96114 WP_000121472.1.96341 WP_000121472.1.96457 WP_000121472.1.965 WP_000121472.1.96585 WP_000121472.1.9661 WP_000121472.1.96659 WP_000121472.1.96944 WP_000121472.1.97248 WP_000121472.1.97685 WP_000121472.1.97932 WP_000121472.1.97937 WP_000121472.1.98026 WP_000121472.1.98292 WP_000121472.1.98301 WP_000121472.1.98451 WP_000121472.1.99046 WP_000121472.1.99246 WP_000121472.1.99304 WP_000121472.1.99334 WP_000121472.1.99361 WP_000121472.1.99475 WP_000121472.1.99592 WP_000121472.1.99666 YP_006777440.1.12065 585055.EC55989_3495 gi|407471052|ref|YP_006782505.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]