SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|407466848|ref|YP_006786710.1| from Escherichia coli O104:H4 str. 2009EL-2071

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|407466848|ref|YP_006786710.1|
Domain Number 1 Region: 6-325
Classification Level Classification E-value
Superfamily FMN-binding split barrel 2.43e-128
Family UbiD middle domain-like 0.00000000000567
Further Details:      
 
Domain Number 2 Region: 326-489
Classification Level Classification E-value
Superfamily UbiD C-terminal domain-like 3.4e-66
Family UbiD C-terminal domain-like 0.0000000146
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|407466848|ref|YP_006786710.1|
Sequence length 497
Comment 3-octaprenyl-4-hydroxybenzoate carboxy-lyase [Escherichia coli O104:H4 str. 2009EL-2071]
Sequence
MDAMKYNDLRDFLTLLEQQGELKRITLPVDPHLEITEIADRTLRAGGPALLFENPKGYSM
PVLCNLFGTPKRVAMGMGQEDVSALREVGKLLAFLKEPEPPKGFRDLFDKLPQFKQVLNM
PTKRLRGAPCQQKIVSGDDVDLNRIPIMTCWPEDAAPLITWGLTVTRGPHKERQNLGIYR
QQLIGKNKLIMRWLSHRGGALDYQEWCAAHPGERFPVSVALGADPATILGAVTPVPDTLS
EYAFAGLLRGTKTEVVKCISNDLEVPASAEIVLEGYIEQGETAPEGPYGDHTGYYNEVDS
FPVFTVTHITQREDAIYHSTYTGRPPDEPAVLGVALNEVFVPILQKQFPEIVDFYLPPEG
CSYRLAVVTIKKQYAGHAKRVMMGVWSFLRQFMYTKFVIVCDDDVNARDWNDVIWAITTR
MDPARDTVLVENTPIDYLDFASPVSGLGSKMGLDATNKWPGETQREWGRPIKKDPDVVAH
IDAIWDELAIFNNGKSA
Download sequence
Identical sequences A0A023Z5Q4 A0A025BQI6 A0A026V1F6 A0A027ZKN3 A0A028E2H4 A0A069XI38 A0A070FA62 A0A070SKY2 A0A070USK9 A0A073FMF7 A0A074HNN6 A0A080FNU7 A0A080IHP1 A0A0A0F8K6 A0A0A8UGB2 A0A0E0Y7F4 A0A0E1M5X3 A0A0E2KYT5 A0A0I4BJC5 A0A0M7PA50 A0A125WWK4 A0A163XEP4 A0A192CF79 A0A1S6THV6 A0A1X3IEU2 A0A1X3IUE0 A0A1X3JAV9 A0A1X3K2S6 A0A1X3KW91 A0A222QT42 A0A236GHH0 A0A2A2XQQ5 B6I4I3 B7L9A4 B7MHC8 C8TYL5 D6I397 D7XME3 D8E9Q7 E0J3V3 E1ITC1 E1J603 E3PAY1 E6BNR3 E9TMR9 E9Z1D7 F4SRP6 F4T605 F4TMK2 F4VLG8 I0VX24 I2REB1 I2RVR5 I2SQE9 I2WCM8 I2WZN6 J7QTE9 J7R864 K4Y7U1 L2VD56 L3C0A7 L3PV43 L4V0F9 P0AAB4 P0AAB5 Q1R469 Q3YVC4 S1IHS4 T6GRR0 T9D8I8 T9RYS1 U9Y045 U9YTS1 W8ZYZ1
gi|218560924|ref|YP_002393837.1| gi|74314354|ref|YP_312773.1| gi|387831753|ref|YP_003351690.1| gi|260857753|ref|YP_003231644.1| gi|386641497|ref|YP_006108295.1| gi|383181098|ref|YP_005459103.1| gi|386636729|ref|YP_006156448.1| gi|556553693|ref|YP_008724219.1| gi|407466848|ref|YP_006786710.1| 199310.c4790 300269.SSON_4016 316385.ECDH10B_4032 316407.ubiD 331111.EcE24377A_4362 364106.UTI89_C4428 405955.APECO1_2614 409438.ECSE_4129 481805.EcolC_4167 511145.b3843 573235.ECO26_4744 585034.ECIAI1_4036 585035.ECS88_4291 585055.EC55989_4318 585395.ECO103_4322 595496.BWG_3519 gi|386606440|ref|YP_006112740.1| gi|170083321|ref|YP_001732641.1| gi|16131689|ref|NP_418285.1| gi|218556407|ref|YP_002389321.1| gi|386711750|ref|YP_006175471.1| gi|238902916|ref|YP_002928712.1| gi|544392265|ref|YP_008567012.1| gi|387614538|ref|YP_006117654.1| gi|91213390|ref|YP_543376.1| gi|26250609|ref|NP_756649.1| gi|260846383|ref|YP_003224161.1| gi|407484426|ref|YP_006781576.1| gi|157155071|ref|YP_001465327.1| gi|378715242|ref|YP_005280135.1| gi|544578405|ref|YP_008573929.1| gi|386601889|ref|YP_006103395.1| gi|387623493|ref|YP_006131121.1| gi|388479409|ref|YP_491601.1| NP_418285.1.90541 WP_000339804.1.100014 WP_000339804.1.100044 WP_000339804.1.100063 WP_000339804.1.100066 WP_000339804.1.100085 WP_000339804.1.100111 WP_000339804.1.100135 WP_000339804.1.100185 WP_000339804.1.100227 WP_000339804.1.100251 WP_000339804.1.100252 WP_000339804.1.100281 WP_000339804.1.100283 WP_000339804.1.100285 WP_000339804.1.100304 WP_000339804.1.100306 WP_000339804.1.100315 WP_000339804.1.10034 WP_000339804.1.100389 WP_000339804.1.100425 WP_000339804.1.100441 WP_000339804.1.100448 WP_000339804.1.100451 WP_000339804.1.100474 WP_000339804.1.10048 WP_000339804.1.100487 WP_000339804.1.100499 WP_000339804.1.10051 WP_000339804.1.100543 WP_000339804.1.100571 WP_000339804.1.100573 WP_000339804.1.100614 WP_000339804.1.10067 WP_000339804.1.10068 WP_000339804.1.100689 WP_000339804.1.100718 WP_000339804.1.100725 WP_000339804.1.100735 WP_000339804.1.100738 WP_000339804.1.100752 WP_000339804.1.100758 WP_000339804.1.100778 WP_000339804.1.100796 WP_000339804.1.10080 WP_000339804.1.100803 WP_000339804.1.100824 WP_000339804.1.100836 WP_000339804.1.100851 WP_000339804.1.100852 WP_000339804.1.100867 WP_000339804.1.100898 WP_000339804.1.100928 WP_000339804.1.100933 WP_000339804.1.100950 WP_000339804.1.100959 WP_000339804.1.100966 WP_000339804.1.100990 WP_000339804.1.101033 WP_000339804.1.101052 WP_000339804.1.101087 WP_000339804.1.101096 WP_000339804.1.101102 WP_000339804.1.101121 WP_000339804.1.101148 WP_000339804.1.101152 WP_000339804.1.101157 WP_000339804.1.101158 WP_000339804.1.101175 WP_000339804.1.101186 WP_000339804.1.101214 WP_000339804.1.101216 WP_000339804.1.101255 WP_000339804.1.101257 WP_000339804.1.101282 WP_000339804.1.101289 WP_000339804.1.101293 WP_000339804.1.10131 WP_000339804.1.101313 WP_000339804.1.101359 WP_000339804.1.10138 WP_000339804.1.101399 WP_000339804.1.101418 WP_000339804.1.101423 WP_000339804.1.101436 WP_000339804.1.101439 WP_000339804.1.101468 WP_000339804.1.101486 WP_000339804.1.10154 WP_000339804.1.101583 WP_000339804.1.101594 WP_000339804.1.101651 WP_000339804.1.101653 WP_000339804.1.101654 WP_000339804.1.101668 WP_000339804.1.101686 WP_000339804.1.101693 WP_000339804.1.101694 WP_000339804.1.10173 WP_000339804.1.101737 WP_000339804.1.101747 WP_000339804.1.101777 WP_000339804.1.10181 WP_000339804.1.101822 WP_000339804.1.10184 WP_000339804.1.101840 WP_000339804.1.101845 WP_000339804.1.101855 WP_000339804.1.101865 WP_000339804.1.10187 WP_000339804.1.10188 WP_000339804.1.101887 WP_000339804.1.101889 WP_000339804.1.10190 WP_000339804.1.101900 WP_000339804.1.101913 WP_000339804.1.101926 WP_000339804.1.101932 WP_000339804.1.101937 WP_000339804.1.101940 WP_000339804.1.101942 WP_000339804.1.101947 WP_000339804.1.101962 WP_000339804.1.101977 WP_000339804.1.101984 WP_000339804.1.102021 WP_000339804.1.102036 WP_000339804.1.102069 WP_000339804.1.102076 WP_000339804.1.102093 WP_000339804.1.102104 WP_000339804.1.102106 WP_000339804.1.102144 WP_000339804.1.10222 WP_000339804.1.10235 WP_000339804.1.10252 WP_000339804.1.10326 WP_000339804.1.10329 WP_000339804.1.10348 WP_000339804.1.10352 WP_000339804.1.10379 WP_000339804.1.10400 WP_000339804.1.10417 WP_000339804.1.10461 WP_000339804.1.10491 WP_000339804.1.10492 WP_000339804.1.10496 WP_000339804.1.10508 WP_000339804.1.10524 WP_000339804.1.10525 WP_000339804.1.10538 WP_000339804.1.10569 WP_000339804.1.10573 WP_000339804.1.10576 WP_000339804.1.10579 WP_000339804.1.10607 WP_000339804.1.10628 WP_000339804.1.10651 WP_000339804.1.10673 WP_000339804.1.10697 WP_000339804.1.1071 WP_000339804.1.10715 WP_000339804.1.1073 WP_000339804.1.1074 WP_000339804.1.10763 WP_000339804.1.10771 WP_000339804.1.10786 WP_000339804.1.10787 WP_000339804.1.10798 WP_000339804.1.10824 WP_000339804.1.10833 WP_000339804.1.10842 WP_000339804.1.10849 WP_000339804.1.10862 WP_000339804.1.10869 WP_000339804.1.10922 WP_000339804.1.10940 WP_000339804.1.10988 WP_000339804.1.10989 WP_000339804.1.10995 WP_000339804.1.11006 WP_000339804.1.11032 WP_000339804.1.11047 WP_000339804.1.11052 WP_000339804.1.11057 WP_000339804.1.11068 WP_000339804.1.11091 WP_000339804.1.11113 WP_000339804.1.11118 WP_000339804.1.11121 WP_000339804.1.1113 WP_000339804.1.11133 WP_000339804.1.112 WP_000339804.1.11217 WP_000339804.1.1122 WP_000339804.1.11241 WP_000339804.1.11250 WP_000339804.1.11251 WP_000339804.1.11272 WP_000339804.1.11285 WP_000339804.1.11315 WP_000339804.1.11323 WP_000339804.1.11408 WP_000339804.1.11411 WP_000339804.1.11436 WP_000339804.1.11440 WP_000339804.1.11452 WP_000339804.1.11467 WP_000339804.1.11499 WP_000339804.1.11519 WP_000339804.1.11524 WP_000339804.1.11531 WP_000339804.1.11542 WP_000339804.1.11575 WP_000339804.1.11578 WP_000339804.1.11595 WP_000339804.1.11607 WP_000339804.1.11612 WP_000339804.1.11645 WP_000339804.1.11673 WP_000339804.1.1168 WP_000339804.1.11699 WP_000339804.1.11748 WP_000339804.1.11759 WP_000339804.1.1176 WP_000339804.1.11762 WP_000339804.1.11801 WP_000339804.1.11803 WP_000339804.1.1186 WP_000339804.1.11949 WP_000339804.1.11955 WP_000339804.1.1196 WP_000339804.1.11981 WP_000339804.1.11982 WP_000339804.1.11985 WP_000339804.1.12000 WP_000339804.1.12009 WP_000339804.1.12010 WP_000339804.1.12030 WP_000339804.1.12051 WP_000339804.1.12076 WP_000339804.1.12088 WP_000339804.1.12095 WP_000339804.1.12111 WP_000339804.1.12112 WP_000339804.1.1212 WP_000339804.1.12151 WP_000339804.1.12157 WP_000339804.1.1218 WP_000339804.1.12204 WP_000339804.1.12230 WP_000339804.1.12268 WP_000339804.1.12279 WP_000339804.1.12292 WP_000339804.1.12295 WP_000339804.1.12319 WP_000339804.1.12320 WP_000339804.1.12342 WP_000339804.1.12344 WP_000339804.1.12415 WP_000339804.1.1242 WP_000339804.1.12426 WP_000339804.1.12478 WP_000339804.1.12542 WP_000339804.1.12558 WP_000339804.1.12566 WP_000339804.1.12623 WP_000339804.1.12645 WP_000339804.1.12680 WP_000339804.1.12693 WP_000339804.1.127 WP_000339804.1.12709 WP_000339804.1.12717 WP_000339804.1.12749 WP_000339804.1.12756 WP_000339804.1.12761 WP_000339804.1.12763 WP_000339804.1.12766 WP_000339804.1.1278 WP_000339804.1.12781 WP_000339804.1.1280 WP_000339804.1.12826 WP_000339804.1.12830 WP_000339804.1.12831 WP_000339804.1.12876 WP_000339804.1.12911 WP_000339804.1.12914 WP_000339804.1.12915 WP_000339804.1.12917 WP_000339804.1.12956 WP_000339804.1.12976 WP_000339804.1.12979 WP_000339804.1.12987 WP_000339804.1.12991 WP_000339804.1.13015 WP_000339804.1.13031 WP_000339804.1.13074 WP_000339804.1.13117 WP_000339804.1.1312 WP_000339804.1.13136 WP_000339804.1.1315 WP_000339804.1.13162 WP_000339804.1.13176 WP_000339804.1.13181 WP_000339804.1.13222 WP_000339804.1.1323 WP_000339804.1.13239 WP_000339804.1.13252 WP_000339804.1.13258 WP_000339804.1.13272 WP_000339804.1.13278 WP_000339804.1.13281 WP_000339804.1.13301 WP_000339804.1.13333 WP_000339804.1.13346 WP_000339804.1.1335 WP_000339804.1.13383 WP_000339804.1.13409 WP_000339804.1.13411 WP_000339804.1.1343 WP_000339804.1.13437 WP_000339804.1.1345 WP_000339804.1.13492 WP_000339804.1.13495 WP_000339804.1.13525 WP_000339804.1.13566 WP_000339804.1.13585 WP_000339804.1.13589 WP_000339804.1.13601 WP_000339804.1.13618 WP_000339804.1.13624 WP_000339804.1.13626 WP_000339804.1.13644 WP_000339804.1.13656 WP_000339804.1.13740 WP_000339804.1.13778 WP_000339804.1.13791 WP_000339804.1.13891 WP_000339804.1.13924 WP_000339804.1.13934 WP_000339804.1.13944 WP_000339804.1.13949 WP_000339804.1.13981 WP_000339804.1.14030 WP_000339804.1.14058 WP_000339804.1.14062 WP_000339804.1.14094 WP_000339804.1.14127 WP_000339804.1.14144 WP_000339804.1.14154 WP_000339804.1.14164 WP_000339804.1.1419 WP_000339804.1.14199 WP_000339804.1.142 WP_000339804.1.14245 WP_000339804.1.14277 WP_000339804.1.14292 WP_000339804.1.14299 WP_000339804.1.14304 WP_000339804.1.14322 WP_000339804.1.14331 WP_000339804.1.14346 WP_000339804.1.14371 WP_000339804.1.1438 WP_000339804.1.1439 WP_000339804.1.14398 WP_000339804.1.14417 WP_000339804.1.14432 WP_000339804.1.14445 WP_000339804.1.14451 WP_000339804.1.14493 WP_000339804.1.14499 WP_000339804.1.14506 WP_000339804.1.14508 WP_000339804.1.14509 WP_000339804.1.14529 WP_000339804.1.14536 WP_000339804.1.14538 WP_000339804.1.14581 WP_000339804.1.14582 WP_000339804.1.14600 WP_000339804.1.14601 WP_000339804.1.1461 WP_000339804.1.14648 WP_000339804.1.14672 WP_000339804.1.14678 WP_000339804.1.14687 WP_000339804.1.14693 WP_000339804.1.1470 WP_000339804.1.14711 WP_000339804.1.14712 WP_000339804.1.14807 WP_000339804.1.14811 WP_000339804.1.14833 WP_000339804.1.1486 WP_000339804.1.14861 WP_000339804.1.14871 WP_000339804.1.14879 WP_000339804.1.14946 WP_000339804.1.14956 WP_000339804.1.14958 WP_000339804.1.14963 WP_000339804.1.14965 WP_000339804.1.14977 WP_000339804.1.14992 WP_000339804.1.14993 WP_000339804.1.15007 WP_000339804.1.15020 WP_000339804.1.1508 WP_000339804.1.15087 WP_000339804.1.1510 WP_000339804.1.15117 WP_000339804.1.1512 WP_000339804.1.15121 WP_000339804.1.15138 WP_000339804.1.15177 WP_000339804.1.15191 WP_000339804.1.15193 WP_000339804.1.15221 WP_000339804.1.1524 WP_000339804.1.15245 WP_000339804.1.15252 WP_000339804.1.15270 WP_000339804.1.15274 WP_000339804.1.15277 WP_000339804.1.15282 WP_000339804.1.15287 WP_000339804.1.15290 WP_000339804.1.15300 WP_000339804.1.15304 WP_000339804.1.15335 WP_000339804.1.15377 WP_000339804.1.15416 WP_000339804.1.1543 WP_000339804.1.15444 WP_000339804.1.15453 WP_000339804.1.15464 WP_000339804.1.15496 WP_000339804.1.15521 WP_000339804.1.15528 WP_000339804.1.15538 WP_000339804.1.15565 WP_000339804.1.15576 WP_000339804.1.15600 WP_000339804.1.1561 WP_000339804.1.15620 WP_000339804.1.15645 WP_000339804.1.15654 WP_000339804.1.15707 WP_000339804.1.15747 WP_000339804.1.15752 WP_000339804.1.15762 WP_000339804.1.15767 WP_000339804.1.15771 WP_000339804.1.15791 WP_000339804.1.1580 WP_000339804.1.15809 WP_000339804.1.15857 WP_000339804.1.15863 WP_000339804.1.15869 WP_000339804.1.1588 WP_000339804.1.15894 WP_000339804.1.15916 WP_000339804.1.15945 WP_000339804.1.15983 WP_000339804.1.15984 WP_000339804.1.15990 WP_000339804.1.16010 WP_000339804.1.16014 WP_000339804.1.16015 WP_000339804.1.1604 WP_000339804.1.16042 WP_000339804.1.16067 WP_000339804.1.16086 WP_000339804.1.1609 WP_000339804.1.16111 WP_000339804.1.16154 WP_000339804.1.16171 WP_000339804.1.16175 WP_000339804.1.16179 WP_000339804.1.16188 WP_000339804.1.16194 WP_000339804.1.1621 WP_000339804.1.16270 WP_000339804.1.16294 WP_000339804.1.163 WP_000339804.1.16303 WP_000339804.1.1634 WP_000339804.1.16387 WP_000339804.1.16388 WP_000339804.1.16396 WP_000339804.1.1640 WP_000339804.1.16435 WP_000339804.1.16482 WP_000339804.1.16517 WP_000339804.1.16532 WP_000339804.1.16539 WP_000339804.1.16577 WP_000339804.1.16592 WP_000339804.1.16604 WP_000339804.1.16640 WP_000339804.1.16648 WP_000339804.1.16669 WP_000339804.1.16700 WP_000339804.1.16705 WP_000339804.1.16715 WP_000339804.1.16721 WP_000339804.1.1673 WP_000339804.1.16745 WP_000339804.1.16752 WP_000339804.1.16799 WP_000339804.1.16805 WP_000339804.1.16807 WP_000339804.1.16843 WP_000339804.1.16861 WP_000339804.1.16894 WP_000339804.1.16970 WP_000339804.1.16992 WP_000339804.1.17014 WP_000339804.1.17018 WP_000339804.1.17042 WP_000339804.1.17084 WP_000339804.1.17085 WP_000339804.1.17087 WP_000339804.1.17089 WP_000339804.1.1710 WP_000339804.1.17101 WP_000339804.1.17102 WP_000339804.1.17109 WP_000339804.1.17111 WP_000339804.1.17114 WP_000339804.1.17123 WP_000339804.1.17170 WP_000339804.1.17172 WP_000339804.1.17182 WP_000339804.1.17186 WP_000339804.1.17205 WP_000339804.1.17206 WP_000339804.1.17216 WP_000339804.1.17230 WP_000339804.1.17242 WP_000339804.1.17290 WP_000339804.1.17297 WP_000339804.1.17300 WP_000339804.1.17301 WP_000339804.1.17325 WP_000339804.1.17356 WP_000339804.1.17373 WP_000339804.1.17389 WP_000339804.1.17392 WP_000339804.1.17403 WP_000339804.1.17410 WP_000339804.1.17417 WP_000339804.1.17432 WP_000339804.1.17441 WP_000339804.1.17461 WP_000339804.1.17464 WP_000339804.1.17534 WP_000339804.1.1754 WP_000339804.1.1755 WP_000339804.1.17570 WP_000339804.1.17577 WP_000339804.1.17584 WP_000339804.1.17595 WP_000339804.1.17637 WP_000339804.1.1766 WP_000339804.1.1769 WP_000339804.1.17701 WP_000339804.1.17765 WP_000339804.1.1778 WP_000339804.1.17802 WP_000339804.1.17829 WP_000339804.1.17836 WP_000339804.1.17849 WP_000339804.1.17889 WP_000339804.1.17920 WP_000339804.1.17925 WP_000339804.1.17937 WP_000339804.1.17961 WP_000339804.1.17963 WP_000339804.1.17984 WP_000339804.1.18000 WP_000339804.1.18006 WP_000339804.1.1802 WP_000339804.1.18024 WP_000339804.1.18050 WP_000339804.1.18064 WP_000339804.1.18094 WP_000339804.1.18118 WP_000339804.1.18133 WP_000339804.1.18175 WP_000339804.1.18226 WP_000339804.1.18229 WP_000339804.1.18275 WP_000339804.1.18311 WP_000339804.1.18316 WP_000339804.1.18329 WP_000339804.1.18337 WP_000339804.1.18338 WP_000339804.1.18348 WP_000339804.1.18354 WP_000339804.1.18381 WP_000339804.1.18394 WP_000339804.1.18438 WP_000339804.1.1844 WP_000339804.1.18482 WP_000339804.1.18511 WP_000339804.1.18519 WP_000339804.1.18530 WP_000339804.1.18550 WP_000339804.1.18556 WP_000339804.1.18583 WP_000339804.1.18628 WP_000339804.1.18649 WP_000339804.1.18650 WP_000339804.1.1866 WP_000339804.1.1867 WP_000339804.1.18675 WP_000339804.1.18699 WP_000339804.1.18714 WP_000339804.1.18725 WP_000339804.1.18726 WP_000339804.1.18734 WP_000339804.1.188 WP_000339804.1.18802 WP_000339804.1.18806 WP_000339804.1.18828 WP_000339804.1.18858 WP_000339804.1.18861 WP_000339804.1.18874 WP_000339804.1.18876 WP_000339804.1.18899 WP_000339804.1.18908 WP_000339804.1.18923 WP_000339804.1.18934 WP_000339804.1.18936 WP_000339804.1.1896 WP_000339804.1.18962 WP_000339804.1.1903 WP_000339804.1.19036 WP_000339804.1.1909 WP_000339804.1.19090 WP_000339804.1.19100 WP_000339804.1.19113 WP_000339804.1.19114 WP_000339804.1.19122 WP_000339804.1.19135 WP_000339804.1.19146 WP_000339804.1.19147 WP_000339804.1.1915 WP_000339804.1.19150 WP_000339804.1.19153 WP_000339804.1.19171 WP_000339804.1.19194 WP_000339804.1.19205 WP_000339804.1.19245 WP_000339804.1.1925 WP_000339804.1.19277 WP_000339804.1.19297 WP_000339804.1.193 WP_000339804.1.19312 WP_000339804.1.19313 WP_000339804.1.19314 WP_000339804.1.19315 WP_000339804.1.19338 WP_000339804.1.19347 WP_000339804.1.19374 WP_000339804.1.19379 WP_000339804.1.19389 WP_000339804.1.19397 WP_000339804.1.19424 WP_000339804.1.19441 WP_000339804.1.19448 WP_000339804.1.19465 WP_000339804.1.19478 WP_000339804.1.19487 WP_000339804.1.19492 WP_000339804.1.19544 WP_000339804.1.19547 WP_000339804.1.19557 WP_000339804.1.19581 WP_000339804.1.19583 WP_000339804.1.19593 WP_000339804.1.1960 WP_000339804.1.19602 WP_000339804.1.1963 WP_000339804.1.19644 WP_000339804.1.19654 WP_000339804.1.19655 WP_000339804.1.19661 WP_000339804.1.19684 WP_000339804.1.19691 WP_000339804.1.19758 WP_000339804.1.19760 WP_000339804.1.19761 WP_000339804.1.19778 WP_000339804.1.1982 WP_000339804.1.19838 WP_000339804.1.19845 WP_000339804.1.1987 WP_000339804.1.19873 WP_000339804.1.19940 WP_000339804.1.19945 WP_000339804.1.19957 WP_000339804.1.19972 WP_000339804.1.19994 WP_000339804.1.20025 WP_000339804.1.20096 WP_000339804.1.20114 WP_000339804.1.20115 WP_000339804.1.20129 WP_000339804.1.20133 WP_000339804.1.20151 WP_000339804.1.20157 WP_000339804.1.20159 WP_000339804.1.20164 WP_000339804.1.20166 WP_000339804.1.20178 WP_000339804.1.20183 WP_000339804.1.20192 WP_000339804.1.2022 WP_000339804.1.20230 WP_000339804.1.20238 WP_000339804.1.2027 WP_000339804.1.20290 WP_000339804.1.20318 WP_000339804.1.20325 WP_000339804.1.20331 WP_000339804.1.20334 WP_000339804.1.20370 WP_000339804.1.20388 WP_000339804.1.20445 WP_000339804.1.20452 WP_000339804.1.20483 WP_000339804.1.20506 WP_000339804.1.20519 WP_000339804.1.20536 WP_000339804.1.20549 WP_000339804.1.20565 WP_000339804.1.20575 WP_000339804.1.20596 WP_000339804.1.20609 WP_000339804.1.2063 WP_000339804.1.20630 WP_000339804.1.20636 WP_000339804.1.20638 WP_000339804.1.20640 WP_000339804.1.20662 WP_000339804.1.20668 WP_000339804.1.20709 WP_000339804.1.20724 WP_000339804.1.20730 WP_000339804.1.20737 WP_000339804.1.20741 WP_000339804.1.20761 WP_000339804.1.20803 WP_000339804.1.20813 WP_000339804.1.20818 WP_000339804.1.20824 WP_000339804.1.20831 WP_000339804.1.20848 WP_000339804.1.20863 WP_000339804.1.2089 WP_000339804.1.2092 WP_000339804.1.2093 WP_000339804.1.20933 WP_000339804.1.2094 WP_000339804.1.20943 WP_000339804.1.20958 WP_000339804.1.20962 WP_000339804.1.20982 WP_000339804.1.2100 WP_000339804.1.21020 WP_000339804.1.21022 WP_000339804.1.21033 WP_000339804.1.21041 WP_000339804.1.21057 WP_000339804.1.21059 WP_000339804.1.21104 WP_000339804.1.21122 WP_000339804.1.21129 WP_000339804.1.2113 WP_000339804.1.21131 WP_000339804.1.21137 WP_000339804.1.21152 WP_000339804.1.21171 WP_000339804.1.21197 WP_000339804.1.21236 WP_000339804.1.21248 WP_000339804.1.21251 WP_000339804.1.21266 WP_000339804.1.21277 WP_000339804.1.21305 WP_000339804.1.21320 WP_000339804.1.21336 WP_000339804.1.21378 WP_000339804.1.2142 WP_000339804.1.21441 WP_000339804.1.21455 WP_000339804.1.21470 WP_000339804.1.21519 WP_000339804.1.21526 WP_000339804.1.21537 WP_000339804.1.2156 WP_000339804.1.21573 WP_000339804.1.21578 WP_000339804.1.21596 WP_000339804.1.21614 WP_000339804.1.21628 WP_000339804.1.21634 WP_000339804.1.21637 WP_000339804.1.2164 WP_000339804.1.21656 WP_000339804.1.21661 WP_000339804.1.21673 WP_000339804.1.21714 WP_000339804.1.21727 WP_000339804.1.21729 WP_000339804.1.21732 WP_000339804.1.21733 WP_000339804.1.21756 WP_000339804.1.21758 WP_000339804.1.21762 WP_000339804.1.21771 WP_000339804.1.21811 WP_000339804.1.21812 WP_000339804.1.21823 WP_000339804.1.21895 WP_000339804.1.21915 WP_000339804.1.21945 WP_000339804.1.21948 WP_000339804.1.22021 WP_000339804.1.22042 WP_000339804.1.22060 WP_000339804.1.22088 WP_000339804.1.22113 WP_000339804.1.22138 WP_000339804.1.22161 WP_000339804.1.22182 WP_000339804.1.22189 WP_000339804.1.22195 WP_000339804.1.22203 WP_000339804.1.22204 WP_000339804.1.22268 WP_000339804.1.22269 WP_000339804.1.22272 WP_000339804.1.22291 WP_000339804.1.22293 WP_000339804.1.22295 WP_000339804.1.2232 WP_000339804.1.22325 WP_000339804.1.22350 WP_000339804.1.22363 WP_000339804.1.2242 WP_000339804.1.2245 WP_000339804.1.22450 WP_000339804.1.22464 WP_000339804.1.22470 WP_000339804.1.22494 WP_000339804.1.22501 WP_000339804.1.22508 WP_000339804.1.22543 WP_000339804.1.22544 WP_000339804.1.22549 WP_000339804.1.22571 WP_000339804.1.22572 WP_000339804.1.22574 WP_000339804.1.22576 WP_000339804.1.22579 WP_000339804.1.22599 WP_000339804.1.22631 WP_000339804.1.22632 WP_000339804.1.22641 WP_000339804.1.22649 WP_000339804.1.22667 WP_000339804.1.22669 WP_000339804.1.22685 WP_000339804.1.22690 WP_000339804.1.22756 WP_000339804.1.22757 WP_000339804.1.22759 WP_000339804.1.22765 WP_000339804.1.22777 WP_000339804.1.22783 WP_000339804.1.22809 WP_000339804.1.22824 WP_000339804.1.22827 WP_000339804.1.22830 WP_000339804.1.22868 WP_000339804.1.22875 WP_000339804.1.22885 WP_000339804.1.22908 WP_000339804.1.22917 WP_000339804.1.22939 WP_000339804.1.22961 WP_000339804.1.22990 WP_000339804.1.22993 WP_000339804.1.2300 WP_000339804.1.23005 WP_000339804.1.23021 WP_000339804.1.23044 WP_000339804.1.23045 WP_000339804.1.23057 WP_000339804.1.23062 WP_000339804.1.23081 WP_000339804.1.23090 WP_000339804.1.23092 WP_000339804.1.23105 WP_000339804.1.23109 WP_000339804.1.23120 WP_000339804.1.23135 WP_000339804.1.23230 WP_000339804.1.23257 WP_000339804.1.23270 WP_000339804.1.23282 WP_000339804.1.23285 WP_000339804.1.23290 WP_000339804.1.23293 WP_000339804.1.23299 WP_000339804.1.23351 WP_000339804.1.23352 WP_000339804.1.23376 WP_000339804.1.23383 WP_000339804.1.23393 WP_000339804.1.23435 WP_000339804.1.23443 WP_000339804.1.23456 WP_000339804.1.23463 WP_000339804.1.23486 WP_000339804.1.23487 WP_000339804.1.23511 WP_000339804.1.23520 WP_000339804.1.23522 WP_000339804.1.23527 WP_000339804.1.2353 WP_000339804.1.23549 WP_000339804.1.23554 WP_000339804.1.23561 WP_000339804.1.23563 WP_000339804.1.23575 WP_000339804.1.23584 WP_000339804.1.23593 WP_000339804.1.23640 WP_000339804.1.23660 WP_000339804.1.23686 WP_000339804.1.23693 WP_000339804.1.23700 WP_000339804.1.23729 WP_000339804.1.23741 WP_000339804.1.23754 WP_000339804.1.23765 WP_000339804.1.23795 WP_000339804.1.23804 WP_000339804.1.23812 WP_000339804.1.23840 WP_000339804.1.23855 WP_000339804.1.23869 WP_000339804.1.23881 WP_000339804.1.23886 WP_000339804.1.23890 WP_000339804.1.23898 WP_000339804.1.23914 WP_000339804.1.23945 WP_000339804.1.23950 WP_000339804.1.23962 WP_000339804.1.23970 WP_000339804.1.23971 WP_000339804.1.24 WP_000339804.1.24004 WP_000339804.1.24038 WP_000339804.1.24045 WP_000339804.1.24051 WP_000339804.1.24058 WP_000339804.1.24068 WP_000339804.1.24089 WP_000339804.1.24120 WP_000339804.1.24124 WP_000339804.1.24127 WP_000339804.1.24136 WP_000339804.1.24169 WP_000339804.1.24177 WP_000339804.1.2418 WP_000339804.1.24194 WP_000339804.1.24233 WP_000339804.1.24278 WP_000339804.1.2428 WP_000339804.1.24290 WP_000339804.1.24362 WP_000339804.1.2437 WP_000339804.1.24381 WP_000339804.1.24383 WP_000339804.1.24460 WP_000339804.1.24473 WP_000339804.1.24483 WP_000339804.1.24485 WP_000339804.1.2449 WP_000339804.1.24523 WP_000339804.1.24524 WP_000339804.1.24533 WP_000339804.1.24536 WP_000339804.1.2456 WP_000339804.1.24560 WP_000339804.1.24570 WP_000339804.1.24575 WP_000339804.1.24577 WP_000339804.1.24583 WP_000339804.1.24616 WP_000339804.1.24634 WP_000339804.1.24641 WP_000339804.1.24642 WP_000339804.1.24646 WP_000339804.1.24650 WP_000339804.1.2469 WP_000339804.1.24693 WP_000339804.1.24695 WP_000339804.1.24773 WP_000339804.1.24783 WP_000339804.1.2479 WP_000339804.1.24791 WP_000339804.1.24797 WP_000339804.1.24799 WP_000339804.1.24808 WP_000339804.1.24849 WP_000339804.1.24854 WP_000339804.1.24876 WP_000339804.1.24899 WP_000339804.1.24906 WP_000339804.1.24909 WP_000339804.1.24939 WP_000339804.1.24960 WP_000339804.1.24968 WP_000339804.1.24979 WP_000339804.1.24981 WP_000339804.1.24984 WP_000339804.1.25019 WP_000339804.1.25021 WP_000339804.1.25039 WP_000339804.1.2504 WP_000339804.1.25060 WP_000339804.1.25079 WP_000339804.1.25085 WP_000339804.1.25086 WP_000339804.1.2512 WP_000339804.1.25141 WP_000339804.1.25174 WP_000339804.1.25203 WP_000339804.1.25289 WP_000339804.1.2531 WP_000339804.1.25324 WP_000339804.1.25346 WP_000339804.1.2537 WP_000339804.1.25372 WP_000339804.1.25380 WP_000339804.1.254 WP_000339804.1.25403 WP_000339804.1.25414 WP_000339804.1.25420 WP_000339804.1.2543 WP_000339804.1.25446 WP_000339804.1.25480 WP_000339804.1.255 WP_000339804.1.25548 WP_000339804.1.2558 WP_000339804.1.25592 WP_000339804.1.25598 WP_000339804.1.25602 WP_000339804.1.25612 WP_000339804.1.25613 WP_000339804.1.25631 WP_000339804.1.25643 WP_000339804.1.25652 WP_000339804.1.2567 WP_000339804.1.25680 WP_000339804.1.25701 WP_000339804.1.25712 WP_000339804.1.25713 WP_000339804.1.25717 WP_000339804.1.25718 WP_000339804.1.25726 WP_000339804.1.25753 WP_000339804.1.25855 WP_000339804.1.25869 WP_000339804.1.25873 WP_000339804.1.25886 WP_000339804.1.2589 WP_000339804.1.25895 WP_000339804.1.25915 WP_000339804.1.25945 WP_000339804.1.26040 WP_000339804.1.26048 WP_000339804.1.2606 WP_000339804.1.26061 WP_000339804.1.26076 WP_000339804.1.26092 WP_000339804.1.26100 WP_000339804.1.2612 WP_000339804.1.26130 WP_000339804.1.26135 WP_000339804.1.26150 WP_000339804.1.26161 WP_000339804.1.26175 WP_000339804.1.26186 WP_000339804.1.26189 WP_000339804.1.26191 WP_000339804.1.26196 WP_000339804.1.26259 WP_000339804.1.26264 WP_000339804.1.26270 WP_000339804.1.26284 WP_000339804.1.26304 WP_000339804.1.26325 WP_000339804.1.26331 WP_000339804.1.2637 WP_000339804.1.26379 WP_000339804.1.26391 WP_000339804.1.26398 WP_000339804.1.26401 WP_000339804.1.26403 WP_000339804.1.2642 WP_000339804.1.26438 WP_000339804.1.26467 WP_000339804.1.26479 WP_000339804.1.26480 WP_000339804.1.26517 WP_000339804.1.26569 WP_000339804.1.26570 WP_000339804.1.26575 WP_000339804.1.26579 WP_000339804.1.26588 WP_000339804.1.26598 WP_000339804.1.26613 WP_000339804.1.26627 WP_000339804.1.26644 WP_000339804.1.26658 WP_000339804.1.26659 WP_000339804.1.26660 WP_000339804.1.26683 WP_000339804.1.26688 WP_000339804.1.26716 WP_000339804.1.26720 WP_000339804.1.26736 WP_000339804.1.26766 WP_000339804.1.26782 WP_000339804.1.26837 WP_000339804.1.26861 WP_000339804.1.2688 WP_000339804.1.26912 WP_000339804.1.26941 WP_000339804.1.26950 WP_000339804.1.26987 WP_000339804.1.26995 WP_000339804.1.2700 WP_000339804.1.27019 WP_000339804.1.27043 WP_000339804.1.27057 WP_000339804.1.27060 WP_000339804.1.27091 WP_000339804.1.27101 WP_000339804.1.27105 WP_000339804.1.27134 WP_000339804.1.27141 WP_000339804.1.27148 WP_000339804.1.27175 WP_000339804.1.27234 WP_000339804.1.27260 WP_000339804.1.27280 WP_000339804.1.27283 WP_000339804.1.27287 WP_000339804.1.27292 WP_000339804.1.2731 WP_000339804.1.27310 WP_000339804.1.27313 WP_000339804.1.27330 WP_000339804.1.27367 WP_000339804.1.27373 WP_000339804.1.27401 WP_000339804.1.2745 WP_000339804.1.27451 WP_000339804.1.27504 WP_000339804.1.27518 WP_000339804.1.27524 WP_000339804.1.2755 WP_000339804.1.27560 WP_000339804.1.27580 WP_000339804.1.27618 WP_000339804.1.27683 WP_000339804.1.27691 WP_000339804.1.27698 WP_000339804.1.27723 WP_000339804.1.27741 WP_000339804.1.27742 WP_000339804.1.27749 WP_000339804.1.27758 WP_000339804.1.27774 WP_000339804.1.27786 WP_000339804.1.2779 WP_000339804.1.27856 WP_000339804.1.27871 WP_000339804.1.27876 WP_000339804.1.27879 WP_000339804.1.27897 WP_000339804.1.27913 WP_000339804.1.27923 WP_000339804.1.27932 WP_000339804.1.2794 WP_000339804.1.27971 WP_000339804.1.27998 WP_000339804.1.28008 WP_000339804.1.28026 WP_000339804.1.28027 WP_000339804.1.28051 WP_000339804.1.28109 WP_000339804.1.28110 WP_000339804.1.28128 WP_000339804.1.28145 WP_000339804.1.28156 WP_000339804.1.28167 WP_000339804.1.28168 WP_000339804.1.2823 WP_000339804.1.2826 WP_000339804.1.28268 WP_000339804.1.28271 WP_000339804.1.28305 WP_000339804.1.28314 WP_000339804.1.28318 WP_000339804.1.28345 WP_000339804.1.28349 WP_000339804.1.28414 WP_000339804.1.28433 WP_000339804.1.28440 WP_000339804.1.28461 WP_000339804.1.28476 WP_000339804.1.28480 WP_000339804.1.28496 WP_000339804.1.285 WP_000339804.1.28500 WP_000339804.1.28509 WP_000339804.1.28523 WP_000339804.1.28540 WP_000339804.1.28554 WP_000339804.1.28662 WP_000339804.1.28683 WP_000339804.1.28697 WP_000339804.1.28711 WP_000339804.1.28723 WP_000339804.1.28732 WP_000339804.1.28736 WP_000339804.1.28742 WP_000339804.1.28760 WP_000339804.1.28762 WP_000339804.1.28769 WP_000339804.1.28791 WP_000339804.1.2881 WP_000339804.1.28829 WP_000339804.1.28835 WP_000339804.1.28842 WP_000339804.1.28919 WP_000339804.1.28924 WP_000339804.1.28950 WP_000339804.1.28982 WP_000339804.1.28994 WP_000339804.1.290 WP_000339804.1.29001 WP_000339804.1.29013 WP_000339804.1.29016 WP_000339804.1.29026 WP_000339804.1.29055 WP_000339804.1.29061 WP_000339804.1.29079 WP_000339804.1.29100 WP_000339804.1.29125 WP_000339804.1.29128 WP_000339804.1.29146 WP_000339804.1.29150 WP_000339804.1.29194 WP_000339804.1.29197 WP_000339804.1.29206 WP_000339804.1.29221 WP_000339804.1.29252 WP_000339804.1.29258 WP_000339804.1.29341 WP_000339804.1.29377 WP_000339804.1.2942 WP_000339804.1.29429 WP_000339804.1.29443 WP_000339804.1.2945 WP_000339804.1.29495 WP_000339804.1.29503 WP_000339804.1.29504 WP_000339804.1.29513 WP_000339804.1.2954 WP_000339804.1.29556 WP_000339804.1.29590 WP_000339804.1.2963 WP_000339804.1.29643 WP_000339804.1.29647 WP_000339804.1.29662 WP_000339804.1.29683 WP_000339804.1.29699 WP_000339804.1.29715 WP_000339804.1.29724 WP_000339804.1.29740 WP_000339804.1.29746 WP_000339804.1.29752 WP_000339804.1.29798 WP_000339804.1.29819 WP_000339804.1.29820 WP_000339804.1.29840 WP_000339804.1.29855 WP_000339804.1.2986 WP_000339804.1.29874 WP_000339804.1.29876 WP_000339804.1.29933 WP_000339804.1.2995 WP_000339804.1.29967 WP_000339804.1.29979 WP_000339804.1.29992 WP_000339804.1.30004 WP_000339804.1.30016 WP_000339804.1.30035 WP_000339804.1.30063 WP_000339804.1.30105 WP_000339804.1.30141 WP_000339804.1.3018 WP_000339804.1.30221 WP_000339804.1.30231 WP_000339804.1.30239 WP_000339804.1.30247 WP_000339804.1.30253 WP_000339804.1.30269 WP_000339804.1.30298 WP_000339804.1.30347 WP_000339804.1.30391 WP_000339804.1.30397 WP_000339804.1.30400 WP_000339804.1.30401 WP_000339804.1.30428 WP_000339804.1.30447 WP_000339804.1.30452 WP_000339804.1.30472 WP_000339804.1.30479 WP_000339804.1.30497 WP_000339804.1.30524 WP_000339804.1.30536 WP_000339804.1.30546 WP_000339804.1.30554 WP_000339804.1.30570 WP_000339804.1.30580 WP_000339804.1.3063 WP_000339804.1.30630 WP_000339804.1.30639 WP_000339804.1.30658 WP_000339804.1.30665 WP_000339804.1.30691 WP_000339804.1.30700 WP_000339804.1.30733 WP_000339804.1.30742 WP_000339804.1.30749 WP_000339804.1.3083 WP_000339804.1.30843 WP_000339804.1.30853 WP_000339804.1.30867 WP_000339804.1.30879 WP_000339804.1.30887 WP_000339804.1.30896 WP_000339804.1.309 WP_000339804.1.30905 WP_000339804.1.30906 WP_000339804.1.30960 WP_000339804.1.31000 WP_000339804.1.31009 WP_000339804.1.31017 WP_000339804.1.31026 WP_000339804.1.31029 WP_000339804.1.31089 WP_000339804.1.31119 WP_000339804.1.31129 WP_000339804.1.31154 WP_000339804.1.31211 WP_000339804.1.31295 WP_000339804.1.31347 WP_000339804.1.31353 WP_000339804.1.31357 WP_000339804.1.31379 WP_000339804.1.31407 WP_000339804.1.31419 WP_000339804.1.31421 WP_000339804.1.31422 WP_000339804.1.31429 WP_000339804.1.31431 WP_000339804.1.31433 WP_000339804.1.31434 WP_000339804.1.3147 WP_000339804.1.31482 WP_000339804.1.31511 WP_000339804.1.31518 WP_000339804.1.31521 WP_000339804.1.31527 WP_000339804.1.31557 WP_000339804.1.31559 WP_000339804.1.31596 WP_000339804.1.31614 WP_000339804.1.31618 WP_000339804.1.31625 WP_000339804.1.31639 WP_000339804.1.31657 WP_000339804.1.31679 WP_000339804.1.31696 WP_000339804.1.31736 WP_000339804.1.31740 WP_000339804.1.31801 WP_000339804.1.31803 WP_000339804.1.31823 WP_000339804.1.31833 WP_000339804.1.31835 WP_000339804.1.31839 WP_000339804.1.31860 WP_000339804.1.31863 WP_000339804.1.31899 WP_000339804.1.31903 WP_000339804.1.31924 WP_000339804.1.31928 WP_000339804.1.3193 WP_000339804.1.31937 WP_000339804.1.31978 WP_000339804.1.32020 WP_000339804.1.32021 WP_000339804.1.32024 WP_000339804.1.32037 WP_000339804.1.32078 WP_000339804.1.32089 WP_000339804.1.32091 WP_000339804.1.32121 WP_000339804.1.32127 WP_000339804.1.32138 WP_000339804.1.32142 WP_000339804.1.32143 WP_000339804.1.3215 WP_000339804.1.32173 WP_000339804.1.32184 WP_000339804.1.32225 WP_000339804.1.32232 WP_000339804.1.32242 WP_000339804.1.32279 WP_000339804.1.3233 WP_000339804.1.32333 WP_000339804.1.32406 WP_000339804.1.32432 WP_000339804.1.32435 WP_000339804.1.32443 WP_000339804.1.32448 WP_000339804.1.3247 WP_000339804.1.32475 WP_000339804.1.32478 WP_000339804.1.32479 WP_000339804.1.3248 WP_000339804.1.32494 WP_000339804.1.32509 WP_000339804.1.32580 WP_000339804.1.32587 WP_000339804.1.3259 WP_000339804.1.32591 WP_000339804.1.32635 WP_000339804.1.32650 WP_000339804.1.32680 WP_000339804.1.3269 WP_000339804.1.327 WP_000339804.1.32709 WP_000339804.1.32715 WP_000339804.1.32718 WP_000339804.1.32720 WP_000339804.1.32741 WP_000339804.1.32748 WP_000339804.1.32811 WP_000339804.1.32815 WP_000339804.1.32831 WP_000339804.1.32835 WP_000339804.1.32875 WP_000339804.1.32903 WP_000339804.1.32910 WP_000339804.1.32938 WP_000339804.1.32959 WP_000339804.1.32992 WP_000339804.1.32995 WP_000339804.1.33004 WP_000339804.1.33018 WP_000339804.1.33022 WP_000339804.1.33053 WP_000339804.1.33119 WP_000339804.1.33171 WP_000339804.1.33217 WP_000339804.1.3323 WP_000339804.1.33237 WP_000339804.1.33244 WP_000339804.1.33303 WP_000339804.1.33325 WP_000339804.1.33341 WP_000339804.1.33362 WP_000339804.1.33385 WP_000339804.1.334 WP_000339804.1.33408 WP_000339804.1.33410 WP_000339804.1.33413 WP_000339804.1.33424 WP_000339804.1.3344 WP_000339804.1.33475 WP_000339804.1.33476 WP_000339804.1.33502 WP_000339804.1.33512 WP_000339804.1.33525 WP_000339804.1.33526 WP_000339804.1.3354 WP_000339804.1.33545 WP_000339804.1.33561 WP_000339804.1.33563 WP_000339804.1.33638 WP_000339804.1.33667 WP_000339804.1.33729 WP_000339804.1.33736 WP_000339804.1.33745 WP_000339804.1.33746 WP_000339804.1.33780 WP_000339804.1.33799 WP_000339804.1.33853 WP_000339804.1.33854 WP_000339804.1.33888 WP_000339804.1.33914 WP_000339804.1.33948 WP_000339804.1.33952 WP_000339804.1.33979 WP_000339804.1.3398 WP_000339804.1.34003 WP_000339804.1.3401 WP_000339804.1.34032 WP_000339804.1.34094 WP_000339804.1.3411 WP_000339804.1.34121 WP_000339804.1.34122 WP_000339804.1.34124 WP_000339804.1.34130 WP_000339804.1.3415 WP_000339804.1.342 WP_000339804.1.34204 WP_000339804.1.34206 WP_000339804.1.34208 WP_000339804.1.34273 WP_000339804.1.34277 WP_000339804.1.34294 WP_000339804.1.34303 WP_000339804.1.3432 WP_000339804.1.34332 WP_000339804.1.34341 WP_000339804.1.34362 WP_000339804.1.34363 WP_000339804.1.34380 WP_000339804.1.3439 WP_000339804.1.34397 WP_000339804.1.3444 WP_000339804.1.34440 WP_000339804.1.34444 WP_000339804.1.34456 WP_000339804.1.34464 WP_000339804.1.34525 WP_000339804.1.34528 WP_000339804.1.34532 WP_000339804.1.34541 WP_000339804.1.34557 WP_000339804.1.3460 WP_000339804.1.34605 WP_000339804.1.34655 WP_000339804.1.34668 WP_000339804.1.34682 WP_000339804.1.34683 WP_000339804.1.347 WP_000339804.1.34763 WP_000339804.1.34781 WP_000339804.1.34782 WP_000339804.1.34794 WP_000339804.1.34827 WP_000339804.1.34835 WP_000339804.1.34855 WP_000339804.1.34875 WP_000339804.1.34887 WP_000339804.1.34913 WP_000339804.1.34931 WP_000339804.1.34948 WP_000339804.1.34983 WP_000339804.1.34990 WP_000339804.1.34993 WP_000339804.1.35006 WP_000339804.1.35007 WP_000339804.1.35107 WP_000339804.1.35114 WP_000339804.1.35127 WP_000339804.1.3515 WP_000339804.1.35186 WP_000339804.1.35195 WP_000339804.1.35198 WP_000339804.1.35202 WP_000339804.1.35204 WP_000339804.1.35208 WP_000339804.1.3521 WP_000339804.1.35211 WP_000339804.1.35258 WP_000339804.1.35328 WP_000339804.1.35360 WP_000339804.1.35365 WP_000339804.1.35376 WP_000339804.1.3539 WP_000339804.1.35394 WP_000339804.1.35398 WP_000339804.1.35464 WP_000339804.1.35465 WP_000339804.1.35466 WP_000339804.1.35468 WP_000339804.1.35483 WP_000339804.1.35578 WP_000339804.1.35581 WP_000339804.1.3560 WP_000339804.1.35604 WP_000339804.1.35627 WP_000339804.1.35651 WP_000339804.1.35653 WP_000339804.1.35654 WP_000339804.1.35724 WP_000339804.1.35740 WP_000339804.1.35741 WP_000339804.1.35789 WP_000339804.1.35889 WP_000339804.1.35904 WP_000339804.1.35934 WP_000339804.1.35942 WP_000339804.1.35959 WP_000339804.1.35963 WP_000339804.1.35983 WP_000339804.1.35987 WP_000339804.1.36040 WP_000339804.1.36042 WP_000339804.1.36070 WP_000339804.1.36085 WP_000339804.1.36094 WP_000339804.1.36132 WP_000339804.1.36158 WP_000339804.1.36159 WP_000339804.1.36166 WP_000339804.1.36177 WP_000339804.1.36182 WP_000339804.1.36207 WP_000339804.1.3624 WP_000339804.1.36281 WP_000339804.1.36299 WP_000339804.1.36332 WP_000339804.1.36334 WP_000339804.1.36386 WP_000339804.1.36393 WP_000339804.1.36405 WP_000339804.1.36412 WP_000339804.1.36414 WP_000339804.1.36426 WP_000339804.1.3643 WP_000339804.1.36459 WP_000339804.1.365 WP_000339804.1.36500 WP_000339804.1.36507 WP_000339804.1.36523 WP_000339804.1.36537 WP_000339804.1.36545 WP_000339804.1.36610 WP_000339804.1.36627 WP_000339804.1.36628 WP_000339804.1.36707 WP_000339804.1.3671 WP_000339804.1.36746 WP_000339804.1.36761 WP_000339804.1.36799 WP_000339804.1.36806 WP_000339804.1.36812 WP_000339804.1.36817 WP_000339804.1.36826 WP_000339804.1.36833 WP_000339804.1.36925 WP_000339804.1.3697 WP_000339804.1.36971 WP_000339804.1.36975 WP_000339804.1.37006 WP_000339804.1.37020 WP_000339804.1.37032 WP_000339804.1.37046 WP_000339804.1.37057 WP_000339804.1.37076 WP_000339804.1.37099 WP_000339804.1.37101 WP_000339804.1.37103 WP_000339804.1.37122 WP_000339804.1.37146 WP_000339804.1.37206 WP_000339804.1.3723 WP_000339804.1.37233 WP_000339804.1.37261 WP_000339804.1.37266 WP_000339804.1.3730 WP_000339804.1.37306 WP_000339804.1.37313 WP_000339804.1.37329 WP_000339804.1.37334 WP_000339804.1.37342 WP_000339804.1.37352 WP_000339804.1.37371 WP_000339804.1.37388 WP_000339804.1.37419 WP_000339804.1.37423 WP_000339804.1.37433 WP_000339804.1.37445 WP_000339804.1.37472 WP_000339804.1.37476 WP_000339804.1.37477 WP_000339804.1.3749 WP_000339804.1.37538 WP_000339804.1.37543 WP_000339804.1.37544 WP_000339804.1.37548 WP_000339804.1.37550 WP_000339804.1.37554 WP_000339804.1.37576 WP_000339804.1.37634 WP_000339804.1.37664 WP_000339804.1.377 WP_000339804.1.3772 WP_000339804.1.37736 WP_000339804.1.37745 WP_000339804.1.37758 WP_000339804.1.37762 WP_000339804.1.37773 WP_000339804.1.37817 WP_000339804.1.37847 WP_000339804.1.37852 WP_000339804.1.37880 WP_000339804.1.37887 WP_000339804.1.37897 WP_000339804.1.37917 WP_000339804.1.37926 WP_000339804.1.37940 WP_000339804.1.3796 WP_000339804.1.37962 WP_000339804.1.37964 WP_000339804.1.37984 WP_000339804.1.37998 WP_000339804.1.38000 WP_000339804.1.38033 WP_000339804.1.38080 WP_000339804.1.38081 WP_000339804.1.38105 WP_000339804.1.3811 WP_000339804.1.38120 WP_000339804.1.3815 WP_000339804.1.38162 WP_000339804.1.38182 WP_000339804.1.38194 WP_000339804.1.3822 WP_000339804.1.38257 WP_000339804.1.38264 WP_000339804.1.38293 WP_000339804.1.38300 WP_000339804.1.38314 WP_000339804.1.38323 WP_000339804.1.38371 WP_000339804.1.38392 WP_000339804.1.38412 WP_000339804.1.38419 WP_000339804.1.38485 WP_000339804.1.38561 WP_000339804.1.38567 WP_000339804.1.38584 WP_000339804.1.38610 WP_000339804.1.38629 WP_000339804.1.38636 WP_000339804.1.38694 WP_000339804.1.38722 WP_000339804.1.3873 WP_000339804.1.38751 WP_000339804.1.38777 WP_000339804.1.38811 WP_000339804.1.38827 WP_000339804.1.38896 WP_000339804.1.38911 WP_000339804.1.38920 WP_000339804.1.38935 WP_000339804.1.38950 WP_000339804.1.38956 WP_000339804.1.39005 WP_000339804.1.39015 WP_000339804.1.3903 WP_000339804.1.39037 WP_000339804.1.3904 WP_000339804.1.39103 WP_000339804.1.39111 WP_000339804.1.39150 WP_000339804.1.39155 WP_000339804.1.39157 WP_000339804.1.39164 WP_000339804.1.39209 WP_000339804.1.3921 WP_000339804.1.39232 WP_000339804.1.39249 WP_000339804.1.39289 WP_000339804.1.39302 WP_000339804.1.39305 WP_000339804.1.39313 WP_000339804.1.39325 WP_000339804.1.39327 WP_000339804.1.39342 WP_000339804.1.39356 WP_000339804.1.39365 WP_000339804.1.39367 WP_000339804.1.39373 WP_000339804.1.39401 WP_000339804.1.39423 WP_000339804.1.39430 WP_000339804.1.39468 WP_000339804.1.39481 WP_000339804.1.39509 WP_000339804.1.39531 WP_000339804.1.3954 WP_000339804.1.39580 WP_000339804.1.39594 WP_000339804.1.39606 WP_000339804.1.39607 WP_000339804.1.39610 WP_000339804.1.39651 WP_000339804.1.39690 WP_000339804.1.3970 WP_000339804.1.39713 WP_000339804.1.39715 WP_000339804.1.39717 WP_000339804.1.39730 WP_000339804.1.39734 WP_000339804.1.39758 WP_000339804.1.39780 WP_000339804.1.39809 WP_000339804.1.39829 WP_000339804.1.39867 WP_000339804.1.39870 WP_000339804.1.39938 WP_000339804.1.39961 WP_000339804.1.39966 WP_000339804.1.39992 WP_000339804.1.40 WP_000339804.1.40016 WP_000339804.1.40019 WP_000339804.1.40088 WP_000339804.1.40107 WP_000339804.1.40121 WP_000339804.1.40159 WP_000339804.1.40183 WP_000339804.1.40190 WP_000339804.1.40192 WP_000339804.1.4020 WP_000339804.1.40206 WP_000339804.1.40211 WP_000339804.1.40212 WP_000339804.1.40218 WP_000339804.1.40238 WP_000339804.1.40249 WP_000339804.1.40298 WP_000339804.1.40300 WP_000339804.1.40317 WP_000339804.1.40319 WP_000339804.1.40335 WP_000339804.1.40345 WP_000339804.1.40349 WP_000339804.1.40360 WP_000339804.1.40382 WP_000339804.1.40391 WP_000339804.1.40403 WP_000339804.1.40445 WP_000339804.1.40486 WP_000339804.1.4049 WP_000339804.1.40499 WP_000339804.1.40502 WP_000339804.1.40509 WP_000339804.1.40524 WP_000339804.1.40548 WP_000339804.1.40560 WP_000339804.1.40563 WP_000339804.1.40596 WP_000339804.1.40599 WP_000339804.1.406 WP_000339804.1.40607 WP_000339804.1.40617 WP_000339804.1.40623 WP_000339804.1.40636 WP_000339804.1.40657 WP_000339804.1.40660 WP_000339804.1.40666 WP_000339804.1.40668 WP_000339804.1.40686 WP_000339804.1.40712 WP_000339804.1.40715 WP_000339804.1.40781 WP_000339804.1.4081 WP_000339804.1.40813 WP_000339804.1.40815 WP_000339804.1.4082 WP_000339804.1.40833 WP_000339804.1.40843 WP_000339804.1.40865 WP_000339804.1.40898 WP_000339804.1.40937 WP_000339804.1.40965 WP_000339804.1.41037 WP_000339804.1.41041 WP_000339804.1.41045 WP_000339804.1.41063 WP_000339804.1.41078 WP_000339804.1.41113 WP_000339804.1.41147 WP_000339804.1.41206 WP_000339804.1.4122 WP_000339804.1.41230 WP_000339804.1.41239 WP_000339804.1.41244 WP_000339804.1.41259 WP_000339804.1.4126 WP_000339804.1.41287 WP_000339804.1.41315 WP_000339804.1.41332 WP_000339804.1.41363 WP_000339804.1.41368 WP_000339804.1.41371 WP_000339804.1.41392 WP_000339804.1.41401 WP_000339804.1.41402 WP_000339804.1.41407 WP_000339804.1.41417 WP_000339804.1.4142 WP_000339804.1.41436 WP_000339804.1.41453 WP_000339804.1.41455 WP_000339804.1.41457 WP_000339804.1.41466 WP_000339804.1.41481 WP_000339804.1.41482 WP_000339804.1.41484 WP_000339804.1.41488 WP_000339804.1.41530 WP_000339804.1.41545 WP_000339804.1.41556 WP_000339804.1.41566 WP_000339804.1.41606 WP_000339804.1.41651 WP_000339804.1.41654 WP_000339804.1.41712 WP_000339804.1.41718 WP_000339804.1.4172 WP_000339804.1.41740 WP_000339804.1.41752 WP_000339804.1.41778 WP_000339804.1.41782 WP_000339804.1.41812 WP_000339804.1.41813 WP_000339804.1.41826 WP_000339804.1.41847 WP_000339804.1.4189 WP_000339804.1.41900 WP_000339804.1.41923 WP_000339804.1.41964 WP_000339804.1.41988 WP_000339804.1.41990 WP_000339804.1.42022 WP_000339804.1.42027 WP_000339804.1.42038 WP_000339804.1.42073 WP_000339804.1.42095 WP_000339804.1.42096 WP_000339804.1.42113 WP_000339804.1.42138 WP_000339804.1.4214 WP_000339804.1.42159 WP_000339804.1.42179 WP_000339804.1.42203 WP_000339804.1.42214 WP_000339804.1.42226 WP_000339804.1.4224 WP_000339804.1.42252 WP_000339804.1.42258 WP_000339804.1.42277 WP_000339804.1.42284 WP_000339804.1.42300 WP_000339804.1.42318 WP_000339804.1.42350 WP_000339804.1.42359 WP_000339804.1.42369 WP_000339804.1.42376 WP_000339804.1.42387 WP_000339804.1.42413 WP_000339804.1.42415 WP_000339804.1.4242 WP_000339804.1.42432 WP_000339804.1.42442 WP_000339804.1.42456 WP_000339804.1.42480 WP_000339804.1.42516 WP_000339804.1.42586 WP_000339804.1.42597 WP_000339804.1.42600 WP_000339804.1.42601 WP_000339804.1.42632 WP_000339804.1.42638 WP_000339804.1.42669 WP_000339804.1.42670 WP_000339804.1.42728 WP_000339804.1.42749 WP_000339804.1.42750 WP_000339804.1.42756 WP_000339804.1.42761 WP_000339804.1.42771 WP_000339804.1.42791 WP_000339804.1.42804 WP_000339804.1.42813 WP_000339804.1.4282 WP_000339804.1.42828 WP_000339804.1.42830 WP_000339804.1.42879 WP_000339804.1.42891 WP_000339804.1.4290 WP_000339804.1.42918 WP_000339804.1.42936 WP_000339804.1.42950 WP_000339804.1.42962 WP_000339804.1.42966 WP_000339804.1.42970 WP_000339804.1.42987 WP_000339804.1.42991 WP_000339804.1.4306 WP_000339804.1.43132 WP_000339804.1.43137 WP_000339804.1.43166 WP_000339804.1.43174 WP_000339804.1.43177 WP_000339804.1.43216 WP_000339804.1.43239 WP_000339804.1.43270 WP_000339804.1.43278 WP_000339804.1.43316 WP_000339804.1.43324 WP_000339804.1.43363 WP_000339804.1.43374 WP_000339804.1.43389 WP_000339804.1.4342 WP_000339804.1.43422 WP_000339804.1.43427 WP_000339804.1.4343 WP_000339804.1.43455 WP_000339804.1.43473 WP_000339804.1.43474 WP_000339804.1.43489 WP_000339804.1.4356 WP_000339804.1.43566 WP_000339804.1.43642 WP_000339804.1.43720 WP_000339804.1.43733 WP_000339804.1.43750 WP_000339804.1.43769 WP_000339804.1.43803 WP_000339804.1.43804 WP_000339804.1.43858 WP_000339804.1.43868 WP_000339804.1.43898 WP_000339804.1.43925 WP_000339804.1.43953 WP_000339804.1.440 WP_000339804.1.4400 WP_000339804.1.44018 WP_000339804.1.44020 WP_000339804.1.44029 WP_000339804.1.44040 WP_000339804.1.44075 WP_000339804.1.44077 WP_000339804.1.44088 WP_000339804.1.44096 WP_000339804.1.44100 WP_000339804.1.4411 WP_000339804.1.44130 WP_000339804.1.44162 WP_000339804.1.44166 WP_000339804.1.44201 WP_000339804.1.44238 WP_000339804.1.44251 WP_000339804.1.44263 WP_000339804.1.44264 WP_000339804.1.44273 WP_000339804.1.44285 WP_000339804.1.44287 WP_000339804.1.44292 WP_000339804.1.44314 WP_000339804.1.44324 WP_000339804.1.44327 WP_000339804.1.44365 WP_000339804.1.44422 WP_000339804.1.44424 WP_000339804.1.44426 WP_000339804.1.44445 WP_000339804.1.44458 WP_000339804.1.44460 WP_000339804.1.44461 WP_000339804.1.4449 WP_000339804.1.44524 WP_000339804.1.44539 WP_000339804.1.44558 WP_000339804.1.44587 WP_000339804.1.4459 WP_000339804.1.44608 WP_000339804.1.44610 WP_000339804.1.44622 WP_000339804.1.44661 WP_000339804.1.44686 WP_000339804.1.44717 WP_000339804.1.44724 WP_000339804.1.4473 WP_000339804.1.44756 WP_000339804.1.448 WP_000339804.1.44800 WP_000339804.1.44814 WP_000339804.1.44818 WP_000339804.1.44841 WP_000339804.1.44843 WP_000339804.1.44848 WP_000339804.1.44849 WP_000339804.1.44854 WP_000339804.1.44857 WP_000339804.1.44923 WP_000339804.1.44960 WP_000339804.1.44961 WP_000339804.1.44970 WP_000339804.1.45028 WP_000339804.1.45043 WP_000339804.1.45053 WP_000339804.1.45068 WP_000339804.1.45104 WP_000339804.1.45156 WP_000339804.1.4516 WP_000339804.1.45190 WP_000339804.1.45208 WP_000339804.1.4524 WP_000339804.1.45246 WP_000339804.1.4530 WP_000339804.1.45301 WP_000339804.1.45329 WP_000339804.1.45359 WP_000339804.1.45405 WP_000339804.1.4541 WP_000339804.1.45444 WP_000339804.1.45494 WP_000339804.1.45500 WP_000339804.1.45525 WP_000339804.1.45536 WP_000339804.1.45581 WP_000339804.1.45595 WP_000339804.1.45600 WP_000339804.1.45627 WP_000339804.1.4563 WP_000339804.1.45664 WP_000339804.1.45676 WP_000339804.1.4570 WP_000339804.1.45718 WP_000339804.1.4574 WP_000339804.1.4576 WP_000339804.1.45789 WP_000339804.1.45793 WP_000339804.1.45801 WP_000339804.1.45806 WP_000339804.1.4583 WP_000339804.1.45840 WP_000339804.1.45846 WP_000339804.1.45865 WP_000339804.1.45868 WP_000339804.1.45891 WP_000339804.1.45921 WP_000339804.1.4593 WP_000339804.1.45930 WP_000339804.1.45933 WP_000339804.1.45960 WP_000339804.1.45962 WP_000339804.1.45968 WP_000339804.1.45990 WP_000339804.1.45991 WP_000339804.1.4600 WP_000339804.1.46016 WP_000339804.1.46026 WP_000339804.1.46027 WP_000339804.1.46048 WP_000339804.1.46049 WP_000339804.1.46070 WP_000339804.1.46081 WP_000339804.1.46097 WP_000339804.1.4610 WP_000339804.1.46105 WP_000339804.1.46115 WP_000339804.1.4613 WP_000339804.1.46164 WP_000339804.1.4617 WP_000339804.1.46186 WP_000339804.1.46197 WP_000339804.1.46213 WP_000339804.1.46239 WP_000339804.1.46245 WP_000339804.1.46257 WP_000339804.1.46263 WP_000339804.1.46291 WP_000339804.1.46301 WP_000339804.1.46325 WP_000339804.1.46329 WP_000339804.1.46378 WP_000339804.1.4643 WP_000339804.1.46433 WP_000339804.1.46438 WP_000339804.1.46441 WP_000339804.1.4646 WP_000339804.1.46468 WP_000339804.1.4647 WP_000339804.1.46477 WP_000339804.1.46526 WP_000339804.1.46541 WP_000339804.1.46552 WP_000339804.1.4657 WP_000339804.1.46582 WP_000339804.1.46589 WP_000339804.1.46602 WP_000339804.1.46614 WP_000339804.1.46616 WP_000339804.1.46655 WP_000339804.1.46668 WP_000339804.1.46734 WP_000339804.1.46743 WP_000339804.1.46795 WP_000339804.1.46798 WP_000339804.1.46802 WP_000339804.1.46806 WP_000339804.1.46820 WP_000339804.1.46821 WP_000339804.1.46833 WP_000339804.1.46857 WP_000339804.1.46860 WP_000339804.1.46876 WP_000339804.1.46898 WP_000339804.1.46909 WP_000339804.1.4691 WP_000339804.1.46912 WP_000339804.1.46932 WP_000339804.1.46990 WP_000339804.1.46991 WP_000339804.1.46999 WP_000339804.1.47028 WP_000339804.1.47030 WP_000339804.1.47038 WP_000339804.1.47039 WP_000339804.1.47047 WP_000339804.1.47048 WP_000339804.1.47050 WP_000339804.1.47054 WP_000339804.1.47063 WP_000339804.1.47069 WP_000339804.1.47156 WP_000339804.1.47189 WP_000339804.1.47197 WP_000339804.1.47224 WP_000339804.1.47235 WP_000339804.1.47246 WP_000339804.1.4725 WP_000339804.1.47280 WP_000339804.1.47307 WP_000339804.1.47316 WP_000339804.1.47319 WP_000339804.1.47332 WP_000339804.1.47350 WP_000339804.1.47356 WP_000339804.1.47363 WP_000339804.1.47366 WP_000339804.1.47370 WP_000339804.1.47398 WP_000339804.1.4740 WP_000339804.1.47401 WP_000339804.1.47414 WP_000339804.1.47416 WP_000339804.1.47425 WP_000339804.1.4743 WP_000339804.1.47451 WP_000339804.1.47454 WP_000339804.1.47464 WP_000339804.1.47473 WP_000339804.1.47477 WP_000339804.1.47488 WP_000339804.1.47496 WP_000339804.1.47498 WP_000339804.1.47529 WP_000339804.1.47533 WP_000339804.1.47555 WP_000339804.1.47582 WP_000339804.1.47634 WP_000339804.1.47654 WP_000339804.1.47662 WP_000339804.1.47709 WP_000339804.1.4773 WP_000339804.1.47734 WP_000339804.1.47744 WP_000339804.1.47761 WP_000339804.1.47765 WP_000339804.1.47770 WP_000339804.1.47790 WP_000339804.1.47820 WP_000339804.1.4783 WP_000339804.1.47848 WP_000339804.1.4785 WP_000339804.1.47914 WP_000339804.1.47935 WP_000339804.1.4796 WP_000339804.1.47962 WP_000339804.1.47976 WP_000339804.1.47981 WP_000339804.1.47983 WP_000339804.1.48000 WP_000339804.1.48018 WP_000339804.1.48040 WP_000339804.1.48051 WP_000339804.1.48073 WP_000339804.1.48087 WP_000339804.1.48096 WP_000339804.1.48111 WP_000339804.1.48121 WP_000339804.1.48144 WP_000339804.1.48194 WP_000339804.1.48203 WP_000339804.1.48222 WP_000339804.1.4826 WP_000339804.1.48265 WP_000339804.1.48285 WP_000339804.1.48290 WP_000339804.1.48291 WP_000339804.1.48317 WP_000339804.1.48353 WP_000339804.1.48355 WP_000339804.1.48404 WP_000339804.1.48417 WP_000339804.1.48421 WP_000339804.1.48431 WP_000339804.1.48433 WP_000339804.1.48469 WP_000339804.1.48483 WP_000339804.1.48505 WP_000339804.1.4857 WP_000339804.1.48571 WP_000339804.1.48590 WP_000339804.1.486 WP_000339804.1.48602 WP_000339804.1.48615 WP_000339804.1.48620 WP_000339804.1.48629 WP_000339804.1.48678 WP_000339804.1.4871 WP_000339804.1.48771 WP_000339804.1.48808 WP_000339804.1.48825 WP_000339804.1.48827 WP_000339804.1.48860 WP_000339804.1.48901 WP_000339804.1.48902 WP_000339804.1.48907 WP_000339804.1.48910 WP_000339804.1.4892 WP_000339804.1.48921 WP_000339804.1.48926 WP_000339804.1.48928 WP_000339804.1.48953 WP_000339804.1.48970 WP_000339804.1.48974 WP_000339804.1.49001 WP_000339804.1.49009 WP_000339804.1.49061 WP_000339804.1.49076 WP_000339804.1.49124 WP_000339804.1.49136 WP_000339804.1.49147 WP_000339804.1.49170 WP_000339804.1.49179 WP_000339804.1.49190 WP_000339804.1.49243 WP_000339804.1.49258 WP_000339804.1.49259 WP_000339804.1.49275 WP_000339804.1.49312 WP_000339804.1.49336 WP_000339804.1.49338 WP_000339804.1.49342 WP_000339804.1.49347 WP_000339804.1.49363 WP_000339804.1.49412 WP_000339804.1.49431 WP_000339804.1.49446 WP_000339804.1.49459 WP_000339804.1.49481 WP_000339804.1.49482 WP_000339804.1.49483 WP_000339804.1.4949 WP_000339804.1.49521 WP_000339804.1.49522 WP_000339804.1.49528 WP_000339804.1.49531 WP_000339804.1.49537 WP_000339804.1.49546 WP_000339804.1.49558 WP_000339804.1.49594 WP_000339804.1.49599 WP_000339804.1.49615 WP_000339804.1.49621 WP_000339804.1.49625 WP_000339804.1.49645 WP_000339804.1.49661 WP_000339804.1.49662 WP_000339804.1.49675 WP_000339804.1.49684 WP_000339804.1.49712 WP_000339804.1.49722 WP_000339804.1.49733 WP_000339804.1.49774 WP_000339804.1.49777 WP_000339804.1.49783 WP_000339804.1.49820 WP_000339804.1.4985 WP_000339804.1.49861 WP_000339804.1.49879 WP_000339804.1.49884 WP_000339804.1.49900 WP_000339804.1.49902 WP_000339804.1.49941 WP_000339804.1.49950 WP_000339804.1.49954 WP_000339804.1.49972 WP_000339804.1.49987 WP_000339804.1.50006 WP_000339804.1.50008 WP_000339804.1.50056 WP_000339804.1.50058 WP_000339804.1.50078 WP_000339804.1.50098 WP_000339804.1.50113 WP_000339804.1.50119 WP_000339804.1.50136 WP_000339804.1.5017 WP_000339804.1.50179 WP_000339804.1.50182 WP_000339804.1.50196 WP_000339804.1.50207 WP_000339804.1.50228 WP_000339804.1.50230 WP_000339804.1.50262 WP_000339804.1.50269 WP_000339804.1.50270 WP_000339804.1.50273 WP_000339804.1.50278 WP_000339804.1.50329 WP_000339804.1.50361 WP_000339804.1.50366 WP_000339804.1.50381 WP_000339804.1.5040 WP_000339804.1.5041 WP_000339804.1.50412 WP_000339804.1.50418 WP_000339804.1.50427 WP_000339804.1.50446 WP_000339804.1.50452 WP_000339804.1.5046 WP_000339804.1.50539 WP_000339804.1.50548 WP_000339804.1.5056 WP_000339804.1.50585 WP_000339804.1.50586 WP_000339804.1.506 WP_000339804.1.5061 WP_000339804.1.50616 WP_000339804.1.50627 WP_000339804.1.5064 WP_000339804.1.5067 WP_000339804.1.50690 WP_000339804.1.50715 WP_000339804.1.50725 WP_000339804.1.50887 WP_000339804.1.50925 WP_000339804.1.50936 WP_000339804.1.50939 WP_000339804.1.5095 WP_000339804.1.50969 WP_000339804.1.50988 WP_000339804.1.50990 WP_000339804.1.50993 WP_000339804.1.50996 WP_000339804.1.51013 WP_000339804.1.51027 WP_000339804.1.51042 WP_000339804.1.511 WP_000339804.1.51109 WP_000339804.1.51127 WP_000339804.1.51170 WP_000339804.1.51172 WP_000339804.1.51175 WP_000339804.1.51180 WP_000339804.1.51190 WP_000339804.1.51201 WP_000339804.1.51211 WP_000339804.1.5124 WP_000339804.1.51248 WP_000339804.1.51253 WP_000339804.1.51260 WP_000339804.1.5128 WP_000339804.1.51283 WP_000339804.1.51299 WP_000339804.1.51320 WP_000339804.1.51323 WP_000339804.1.51330 WP_000339804.1.51336 WP_000339804.1.51354 WP_000339804.1.51364 WP_000339804.1.51392 WP_000339804.1.51405 WP_000339804.1.51425 WP_000339804.1.51426 WP_000339804.1.51427 WP_000339804.1.51430 WP_000339804.1.5146 WP_000339804.1.51462 WP_000339804.1.51482 WP_000339804.1.51490 WP_000339804.1.51495 WP_000339804.1.51503 WP_000339804.1.51513 WP_000339804.1.51525 WP_000339804.1.51537 WP_000339804.1.51539 WP_000339804.1.51542 WP_000339804.1.51552 WP_000339804.1.5157 WP_000339804.1.5158 WP_000339804.1.51580 WP_000339804.1.51587 WP_000339804.1.51596 WP_000339804.1.51624 WP_000339804.1.51629 WP_000339804.1.51662 WP_000339804.1.51707 WP_000339804.1.51718 WP_000339804.1.5172 WP_000339804.1.51757 WP_000339804.1.51784 WP_000339804.1.518 WP_000339804.1.51804 WP_000339804.1.51837 WP_000339804.1.51839 WP_000339804.1.51869 WP_000339804.1.51873 WP_000339804.1.51881 WP_000339804.1.51896 WP_000339804.1.51899 WP_000339804.1.51906 WP_000339804.1.51944 WP_000339804.1.51968 WP_000339804.1.51985 WP_000339804.1.51988 WP_000339804.1.5199 WP_000339804.1.52011 WP_000339804.1.52020 WP_000339804.1.52044 WP_000339804.1.52048 WP_000339804.1.52076 WP_000339804.1.52085 WP_000339804.1.52098 WP_000339804.1.52111 WP_000339804.1.52126 WP_000339804.1.52127 WP_000339804.1.52137 WP_000339804.1.52171 WP_000339804.1.52186 WP_000339804.1.52200 WP_000339804.1.52211 WP_000339804.1.52214 WP_000339804.1.52225 WP_000339804.1.52230 WP_000339804.1.52236 WP_000339804.1.52240 WP_000339804.1.52243 WP_000339804.1.52249 WP_000339804.1.5227 WP_000339804.1.52272 WP_000339804.1.52299 WP_000339804.1.52304 WP_000339804.1.52305 WP_000339804.1.52324 WP_000339804.1.52328 WP_000339804.1.52333 WP_000339804.1.52363 WP_000339804.1.52378 WP_000339804.1.5239 WP_000339804.1.52399 WP_000339804.1.52413 WP_000339804.1.52492 WP_000339804.1.52542 WP_000339804.1.52544 WP_000339804.1.52554 WP_000339804.1.52558 WP_000339804.1.52567 WP_000339804.1.52601 WP_000339804.1.52612 WP_000339804.1.52631 WP_000339804.1.5265 WP_000339804.1.52662 WP_000339804.1.52691 WP_000339804.1.52710 WP_000339804.1.52735 WP_000339804.1.52755 WP_000339804.1.52762 WP_000339804.1.52774 WP_000339804.1.52777 WP_000339804.1.52780 WP_000339804.1.5285 WP_000339804.1.52852 WP_000339804.1.52853 WP_000339804.1.52881 WP_000339804.1.52895 WP_000339804.1.52913 WP_000339804.1.52942 WP_000339804.1.52945 WP_000339804.1.52962 WP_000339804.1.52995 WP_000339804.1.52996 WP_000339804.1.53012 WP_000339804.1.53020 WP_000339804.1.53021 WP_000339804.1.53027 WP_000339804.1.53065 WP_000339804.1.53095 WP_000339804.1.53099 WP_000339804.1.5310 WP_000339804.1.53155 WP_000339804.1.53162 WP_000339804.1.53186 WP_000339804.1.532 WP_000339804.1.5322 WP_000339804.1.53223 WP_000339804.1.53228 WP_000339804.1.53242 WP_000339804.1.53244 WP_000339804.1.53251 WP_000339804.1.53262 WP_000339804.1.53277 WP_000339804.1.53308 WP_000339804.1.53327 WP_000339804.1.53356 WP_000339804.1.53364 WP_000339804.1.53377 WP_000339804.1.53401 WP_000339804.1.53410 WP_000339804.1.53415 WP_000339804.1.53419 WP_000339804.1.5342 WP_000339804.1.53428 WP_000339804.1.53431 WP_000339804.1.53505 WP_000339804.1.5351 WP_000339804.1.53535 WP_000339804.1.53537 WP_000339804.1.53545 WP_000339804.1.53574 WP_000339804.1.53587 WP_000339804.1.53592 WP_000339804.1.53594 WP_000339804.1.5362 WP_000339804.1.53642 WP_000339804.1.53690 WP_000339804.1.53693 WP_000339804.1.53706 WP_000339804.1.53769 WP_000339804.1.53810 WP_000339804.1.53811 WP_000339804.1.53841 WP_000339804.1.53863 WP_000339804.1.53878 WP_000339804.1.53884 WP_000339804.1.5391 WP_000339804.1.5393 WP_000339804.1.53931 WP_000339804.1.53940 WP_000339804.1.5395 WP_000339804.1.53966 WP_000339804.1.53968 WP_000339804.1.53972 WP_000339804.1.53978 WP_000339804.1.54002 WP_000339804.1.54013 WP_000339804.1.54023 WP_000339804.1.54028 WP_000339804.1.54051 WP_000339804.1.54072 WP_000339804.1.54091 WP_000339804.1.54095 WP_000339804.1.54102 WP_000339804.1.54144 WP_000339804.1.54169 WP_000339804.1.54188 WP_000339804.1.54202 WP_000339804.1.54208 WP_000339804.1.54313 WP_000339804.1.54317 WP_000339804.1.54328 WP_000339804.1.54329 WP_000339804.1.5433 WP_000339804.1.5434 WP_000339804.1.54344 WP_000339804.1.54359 WP_000339804.1.54388 WP_000339804.1.54394 WP_000339804.1.5440 WP_000339804.1.54417 WP_000339804.1.54418 WP_000339804.1.54429 WP_000339804.1.54439 WP_000339804.1.54463 WP_000339804.1.54507 WP_000339804.1.54534 WP_000339804.1.54546 WP_000339804.1.54590 WP_000339804.1.54591 WP_000339804.1.5460 WP_000339804.1.54602 WP_000339804.1.54605 WP_000339804.1.5461 WP_000339804.1.54614 WP_000339804.1.54617 WP_000339804.1.54620 WP_000339804.1.54638 WP_000339804.1.54641 WP_000339804.1.54688 WP_000339804.1.54708 WP_000339804.1.54725 WP_000339804.1.54729 WP_000339804.1.54754 WP_000339804.1.54769 WP_000339804.1.5478 WP_000339804.1.5479 WP_000339804.1.54798 WP_000339804.1.54829 WP_000339804.1.54875 WP_000339804.1.54918 WP_000339804.1.54921 WP_000339804.1.54927 WP_000339804.1.54940 WP_000339804.1.54941 WP_000339804.1.54946 WP_000339804.1.54981 WP_000339804.1.54991 WP_000339804.1.55003 WP_000339804.1.55005 WP_000339804.1.55009 WP_000339804.1.55041 WP_000339804.1.55112 WP_000339804.1.55115 WP_000339804.1.55123 WP_000339804.1.55134 WP_000339804.1.55144 WP_000339804.1.55149 WP_000339804.1.55151 WP_000339804.1.55177 WP_000339804.1.55179 WP_000339804.1.55197 WP_000339804.1.55203 WP_000339804.1.55222 WP_000339804.1.55226 WP_000339804.1.55273 WP_000339804.1.55291 WP_000339804.1.55338 WP_000339804.1.55342 WP_000339804.1.55359 WP_000339804.1.55374 WP_000339804.1.55381 WP_000339804.1.55417 WP_000339804.1.55420 WP_000339804.1.55424 WP_000339804.1.55425 WP_000339804.1.55466 WP_000339804.1.55472 WP_000339804.1.55482 WP_000339804.1.55483 WP_000339804.1.55489 WP_000339804.1.55550 WP_000339804.1.55551 WP_000339804.1.55552 WP_000339804.1.55556 WP_000339804.1.55560 WP_000339804.1.55571 WP_000339804.1.55581 WP_000339804.1.55597 WP_000339804.1.55608 WP_000339804.1.5561 WP_000339804.1.55629 WP_000339804.1.5566 WP_000339804.1.55676 WP_000339804.1.5570 WP_000339804.1.55709 WP_000339804.1.55720 WP_000339804.1.55727 WP_000339804.1.55730 WP_000339804.1.55731 WP_000339804.1.55744 WP_000339804.1.55787 WP_000339804.1.55790 WP_000339804.1.55808 WP_000339804.1.55825 WP_000339804.1.55844 WP_000339804.1.55868 WP_000339804.1.55888 WP_000339804.1.55936 WP_000339804.1.55979 WP_000339804.1.55981 WP_000339804.1.55988 WP_000339804.1.55990 WP_000339804.1.56033 WP_000339804.1.56040 WP_000339804.1.561 WP_000339804.1.56101 WP_000339804.1.56122 WP_000339804.1.56139 WP_000339804.1.5614 WP_000339804.1.56142 WP_000339804.1.56149 WP_000339804.1.5616 WP_000339804.1.56164 WP_000339804.1.56177 WP_000339804.1.56193 WP_000339804.1.562 WP_000339804.1.56216 WP_000339804.1.56231 WP_000339804.1.56278 WP_000339804.1.56302 WP_000339804.1.5632 WP_000339804.1.56338 WP_000339804.1.56345 WP_000339804.1.56371 WP_000339804.1.56388 WP_000339804.1.56390 WP_000339804.1.56399 WP_000339804.1.56402 WP_000339804.1.56439 WP_000339804.1.56446 WP_000339804.1.56457 WP_000339804.1.5646 WP_000339804.1.56469 WP_000339804.1.5649 WP_000339804.1.56501 WP_000339804.1.56502 WP_000339804.1.56513 WP_000339804.1.56523 WP_000339804.1.56528 WP_000339804.1.56543 WP_000339804.1.56573 WP_000339804.1.56586 WP_000339804.1.56650 WP_000339804.1.56662 WP_000339804.1.56680 WP_000339804.1.5670 WP_000339804.1.56704 WP_000339804.1.56713 WP_000339804.1.56714 WP_000339804.1.56721 WP_000339804.1.56776 WP_000339804.1.56777 WP_000339804.1.56786 WP_000339804.1.56787 WP_000339804.1.56789 WP_000339804.1.56799 WP_000339804.1.56821 WP_000339804.1.56830 WP_000339804.1.56835 WP_000339804.1.5685 WP_000339804.1.56871 WP_000339804.1.56882 WP_000339804.1.56908 WP_000339804.1.56933 WP_000339804.1.56934 WP_000339804.1.56936 WP_000339804.1.56937 WP_000339804.1.56941 WP_000339804.1.56951 WP_000339804.1.56978 WP_000339804.1.56992 WP_000339804.1.57045 WP_000339804.1.57051 WP_000339804.1.57072 WP_000339804.1.57079 WP_000339804.1.57086 WP_000339804.1.57100 WP_000339804.1.57124 WP_000339804.1.57181 WP_000339804.1.57202 WP_000339804.1.57213 WP_000339804.1.57216 WP_000339804.1.57222 WP_000339804.1.57254 WP_000339804.1.57266 WP_000339804.1.57269 WP_000339804.1.57278 WP_000339804.1.57281 WP_000339804.1.57319 WP_000339804.1.57401 WP_000339804.1.57410 WP_000339804.1.57414 WP_000339804.1.57451 WP_000339804.1.5748 WP_000339804.1.57487 WP_000339804.1.57517 WP_000339804.1.57538 WP_000339804.1.57539 WP_000339804.1.5755 WP_000339804.1.57558 WP_000339804.1.57574 WP_000339804.1.57588 WP_000339804.1.57608 WP_000339804.1.57628 WP_000339804.1.57629 WP_000339804.1.57634 WP_000339804.1.57638 WP_000339804.1.57659 WP_000339804.1.57663 WP_000339804.1.57719 WP_000339804.1.57738 WP_000339804.1.57812 WP_000339804.1.57832 WP_000339804.1.57846 WP_000339804.1.57854 WP_000339804.1.5786 WP_000339804.1.5787 WP_000339804.1.57898 WP_000339804.1.57903 WP_000339804.1.57920 WP_000339804.1.57951 WP_000339804.1.57975 WP_000339804.1.58001 WP_000339804.1.58009 WP_000339804.1.58022 WP_000339804.1.58038 WP_000339804.1.58045 WP_000339804.1.58060 WP_000339804.1.58080 WP_000339804.1.58092 WP_000339804.1.58094 WP_000339804.1.5810 WP_000339804.1.58107 WP_000339804.1.5812 WP_000339804.1.58128 WP_000339804.1.58143 WP_000339804.1.58146 WP_000339804.1.58163 WP_000339804.1.58206 WP_000339804.1.58226 WP_000339804.1.58232 WP_000339804.1.58233 WP_000339804.1.58244 WP_000339804.1.58248 WP_000339804.1.58267 WP_000339804.1.58289 WP_000339804.1.58292 WP_000339804.1.58340 WP_000339804.1.58345 WP_000339804.1.58368 WP_000339804.1.58371 WP_000339804.1.58384 WP_000339804.1.58401 WP_000339804.1.58408 WP_000339804.1.58414 WP_000339804.1.5842 WP_000339804.1.58420 WP_000339804.1.58424 WP_000339804.1.58429 WP_000339804.1.58440 WP_000339804.1.58445 WP_000339804.1.58449 WP_000339804.1.58459 WP_000339804.1.58484 WP_000339804.1.58493 WP_000339804.1.58496 WP_000339804.1.585 WP_000339804.1.58507 WP_000339804.1.58514 WP_000339804.1.58528 WP_000339804.1.58547 WP_000339804.1.58552 WP_000339804.1.58572 WP_000339804.1.58582 WP_000339804.1.58609 WP_000339804.1.58657 WP_000339804.1.58680 WP_000339804.1.58705 WP_000339804.1.58837 WP_000339804.1.58867 WP_000339804.1.58870 WP_000339804.1.58901 WP_000339804.1.58942 WP_000339804.1.58951 WP_000339804.1.58958 WP_000339804.1.58976 WP_000339804.1.58977 WP_000339804.1.59024 WP_000339804.1.59026 WP_000339804.1.59047 WP_000339804.1.5906 WP_000339804.1.59060 WP_000339804.1.59073 WP_000339804.1.59083 WP_000339804.1.59174 WP_000339804.1.59190 WP_000339804.1.59199 WP_000339804.1.59218 WP_000339804.1.5927 WP_000339804.1.59280 WP_000339804.1.59291 WP_000339804.1.59292 WP_000339804.1.59293 WP_000339804.1.59302 WP_000339804.1.59395 WP_000339804.1.59396 WP_000339804.1.59407 WP_000339804.1.59413 WP_000339804.1.5942 WP_000339804.1.59423 WP_000339804.1.59426 WP_000339804.1.59434 WP_000339804.1.59483 WP_000339804.1.59533 WP_000339804.1.59553 WP_000339804.1.59572 WP_000339804.1.59579 WP_000339804.1.59590 WP_000339804.1.59611 WP_000339804.1.59613 WP_000339804.1.59615 WP_000339804.1.59621 WP_000339804.1.59638 WP_000339804.1.59660 WP_000339804.1.59689 WP_000339804.1.59699 WP_000339804.1.597 WP_000339804.1.59714 WP_000339804.1.59730 WP_000339804.1.59737 WP_000339804.1.59745 WP_000339804.1.59756 WP_000339804.1.59781 WP_000339804.1.59782 WP_000339804.1.59793 WP_000339804.1.59815 WP_000339804.1.59823 WP_000339804.1.59836 WP_000339804.1.59855 WP_000339804.1.59858 WP_000339804.1.59894 WP_000339804.1.5990 WP_000339804.1.59900 WP_000339804.1.59914 WP_000339804.1.59932 WP_000339804.1.59970 WP_000339804.1.59980 WP_000339804.1.59981 WP_000339804.1.59998 WP_000339804.1.60005 WP_000339804.1.6002 WP_000339804.1.60023 WP_000339804.1.60031 WP_000339804.1.60070 WP_000339804.1.60095 WP_000339804.1.60133 WP_000339804.1.60186 WP_000339804.1.6022 WP_000339804.1.60228 WP_000339804.1.60235 WP_000339804.1.60246 WP_000339804.1.60325 WP_000339804.1.60350 WP_000339804.1.60373 WP_000339804.1.60387 WP_000339804.1.60411 WP_000339804.1.60443 WP_000339804.1.60457 WP_000339804.1.60491 WP_000339804.1.60498 WP_000339804.1.60505 WP_000339804.1.60550 WP_000339804.1.60559 WP_000339804.1.60570 WP_000339804.1.60576 WP_000339804.1.6059 WP_000339804.1.60591 WP_000339804.1.60599 WP_000339804.1.6061 WP_000339804.1.60614 WP_000339804.1.60630 WP_000339804.1.6064 WP_000339804.1.60644 WP_000339804.1.60654 WP_000339804.1.6066 WP_000339804.1.60671 WP_000339804.1.60684 WP_000339804.1.60698 WP_000339804.1.60717 WP_000339804.1.60732 WP_000339804.1.60764 WP_000339804.1.60771 WP_000339804.1.60805 WP_000339804.1.60816 WP_000339804.1.60826 WP_000339804.1.60832 WP_000339804.1.60835 WP_000339804.1.60847 WP_000339804.1.60895 WP_000339804.1.60901 WP_000339804.1.60921 WP_000339804.1.60925 WP_000339804.1.60927 WP_000339804.1.6094 WP_000339804.1.60974 WP_000339804.1.61005 WP_000339804.1.61035 WP_000339804.1.61046 WP_000339804.1.61058 WP_000339804.1.6106 WP_000339804.1.61096 WP_000339804.1.61097 WP_000339804.1.61102 WP_000339804.1.61112 WP_000339804.1.61121 WP_000339804.1.61148 WP_000339804.1.61170 WP_000339804.1.61174 WP_000339804.1.61183 WP_000339804.1.61223 WP_000339804.1.61225 WP_000339804.1.61241 WP_000339804.1.61245 WP_000339804.1.61268 WP_000339804.1.613 WP_000339804.1.61362 WP_000339804.1.61373 WP_000339804.1.6138 WP_000339804.1.61398 WP_000339804.1.61442 WP_000339804.1.61445 WP_000339804.1.61496 WP_000339804.1.615 WP_000339804.1.61505 WP_000339804.1.61517 WP_000339804.1.61524 WP_000339804.1.61551 WP_000339804.1.61608 WP_000339804.1.61612 WP_000339804.1.61617 WP_000339804.1.61643 WP_000339804.1.61663 WP_000339804.1.61703 WP_000339804.1.61718 WP_000339804.1.61739 WP_000339804.1.61758 WP_000339804.1.61770 WP_000339804.1.61779 WP_000339804.1.61789 WP_000339804.1.61806 WP_000339804.1.61822 WP_000339804.1.61835 WP_000339804.1.61853 WP_000339804.1.61858 WP_000339804.1.61893 WP_000339804.1.61926 WP_000339804.1.61939 WP_000339804.1.61949 WP_000339804.1.61957 WP_000339804.1.61966 WP_000339804.1.62038 WP_000339804.1.62041 WP_000339804.1.62091 WP_000339804.1.62099 WP_000339804.1.62102 WP_000339804.1.6212 WP_000339804.1.62157 WP_000339804.1.62236 WP_000339804.1.62264 WP_000339804.1.62296 WP_000339804.1.62303 WP_000339804.1.62322 WP_000339804.1.62337 WP_000339804.1.62348 WP_000339804.1.62358 WP_000339804.1.62447 WP_000339804.1.6245 WP_000339804.1.62454 WP_000339804.1.62503 WP_000339804.1.62507 WP_000339804.1.62513 WP_000339804.1.62514 WP_000339804.1.62529 WP_000339804.1.62586 WP_000339804.1.62612 WP_000339804.1.62642 WP_000339804.1.62646 WP_000339804.1.62668 WP_000339804.1.62681 WP_000339804.1.62735 WP_000339804.1.62750 WP_000339804.1.62762 WP_000339804.1.62769 WP_000339804.1.62780 WP_000339804.1.62784 WP_000339804.1.62787 WP_000339804.1.62788 WP_000339804.1.62802 WP_000339804.1.62812 WP_000339804.1.62819 WP_000339804.1.6282 WP_000339804.1.62840 WP_000339804.1.62850 WP_000339804.1.62851 WP_000339804.1.62866 WP_000339804.1.62885 WP_000339804.1.62914 WP_000339804.1.62919 WP_000339804.1.6293 WP_000339804.1.62931 WP_000339804.1.62951 WP_000339804.1.62959 WP_000339804.1.62973 WP_000339804.1.62989 WP_000339804.1.6299 WP_000339804.1.62992 WP_000339804.1.63023 WP_000339804.1.63113 WP_000339804.1.63167 WP_000339804.1.63177 WP_000339804.1.63189 WP_000339804.1.63246 WP_000339804.1.63271 WP_000339804.1.63285 WP_000339804.1.63287 WP_000339804.1.63310 WP_000339804.1.6334 WP_000339804.1.6337 WP_000339804.1.63370 WP_000339804.1.63374 WP_000339804.1.63393 WP_000339804.1.63419 WP_000339804.1.63435 WP_000339804.1.63437 WP_000339804.1.63453 WP_000339804.1.63465 WP_000339804.1.63466 WP_000339804.1.63467 WP_000339804.1.63470 WP_000339804.1.63478 WP_000339804.1.6348 WP_000339804.1.63484 WP_000339804.1.63491 WP_000339804.1.63536 WP_000339804.1.63556 WP_000339804.1.63576 WP_000339804.1.63602 WP_000339804.1.63666 WP_000339804.1.63683 WP_000339804.1.63703 WP_000339804.1.63746 WP_000339804.1.63800 WP_000339804.1.63810 WP_000339804.1.63814 WP_000339804.1.63821 WP_000339804.1.63871 WP_000339804.1.63964 WP_000339804.1.63990 WP_000339804.1.64008 WP_000339804.1.64030 WP_000339804.1.64040 WP_000339804.1.64045 WP_000339804.1.64050 WP_000339804.1.64053 WP_000339804.1.64074 WP_000339804.1.64150 WP_000339804.1.6416 WP_000339804.1.64165 WP_000339804.1.64175 WP_000339804.1.64180 WP_000339804.1.64190 WP_000339804.1.64193 WP_000339804.1.64280 WP_000339804.1.64285 WP_000339804.1.64286 WP_000339804.1.643 WP_000339804.1.6431 WP_000339804.1.64321 WP_000339804.1.64356 WP_000339804.1.64380 WP_000339804.1.64391 WP_000339804.1.6441 WP_000339804.1.64417 WP_000339804.1.64437 WP_000339804.1.64438 WP_000339804.1.6444 WP_000339804.1.64448 WP_000339804.1.64458 WP_000339804.1.64519 WP_000339804.1.64528 WP_000339804.1.64540 WP_000339804.1.64563 WP_000339804.1.64634 WP_000339804.1.64657 WP_000339804.1.64670 WP_000339804.1.6469 WP_000339804.1.64693 WP_000339804.1.647 WP_000339804.1.64707 WP_000339804.1.64712 WP_000339804.1.64746 WP_000339804.1.64784 WP_000339804.1.64789 WP_000339804.1.64821 WP_000339804.1.64866 WP_000339804.1.64875 WP_000339804.1.64881 WP_000339804.1.64895 WP_000339804.1.64912 WP_000339804.1.64926 WP_000339804.1.64939 WP_000339804.1.64970 WP_000339804.1.64990 WP_000339804.1.6500 WP_000339804.1.65023 WP_000339804.1.65040 WP_000339804.1.65061 WP_000339804.1.65097 WP_000339804.1.651 WP_000339804.1.65104 WP_000339804.1.65110 WP_000339804.1.65114 WP_000339804.1.65116 WP_000339804.1.65122 WP_000339804.1.65135 WP_000339804.1.65151 WP_000339804.1.65155 WP_000339804.1.6516 WP_000339804.1.65179 WP_000339804.1.65192 WP_000339804.1.65206 WP_000339804.1.65240 WP_000339804.1.65256 WP_000339804.1.6527 WP_000339804.1.65286 WP_000339804.1.65296 WP_000339804.1.65305 WP_000339804.1.65306 WP_000339804.1.65353 WP_000339804.1.65355 WP_000339804.1.65364 WP_000339804.1.65366 WP_000339804.1.6537 WP_000339804.1.65370 WP_000339804.1.654 WP_000339804.1.65405 WP_000339804.1.65408 WP_000339804.1.65493 WP_000339804.1.6553 WP_000339804.1.65531 WP_000339804.1.65565 WP_000339804.1.65571 WP_000339804.1.65581 WP_000339804.1.65596 WP_000339804.1.65606 WP_000339804.1.6563 WP_000339804.1.65667 WP_000339804.1.65672 WP_000339804.1.65677 WP_000339804.1.65708 WP_000339804.1.65714 WP_000339804.1.65749 WP_000339804.1.6576 WP_000339804.1.65762 WP_000339804.1.65834 WP_000339804.1.65954 WP_000339804.1.65957 WP_000339804.1.65961 WP_000339804.1.65962 WP_000339804.1.6599 WP_000339804.1.65991 WP_000339804.1.66001 WP_000339804.1.66007 WP_000339804.1.66017 WP_000339804.1.66022 WP_000339804.1.6604 WP_000339804.1.66044 WP_000339804.1.66050 WP_000339804.1.66071 WP_000339804.1.66094 WP_000339804.1.66102 WP_000339804.1.66104 WP_000339804.1.66105 WP_000339804.1.66121 WP_000339804.1.6618 WP_000339804.1.66181 WP_000339804.1.66197 WP_000339804.1.6622 WP_000339804.1.66255 WP_000339804.1.66264 WP_000339804.1.66288 WP_000339804.1.66295 WP_000339804.1.66327 WP_000339804.1.66335 WP_000339804.1.6635 WP_000339804.1.66376 WP_000339804.1.66387 WP_000339804.1.66389 WP_000339804.1.66392 WP_000339804.1.66395 WP_000339804.1.66412 WP_000339804.1.66421 WP_000339804.1.66432 WP_000339804.1.6645 WP_000339804.1.66501 WP_000339804.1.66523 WP_000339804.1.6654 WP_000339804.1.66550 WP_000339804.1.66559 WP_000339804.1.66579 WP_000339804.1.66624 WP_000339804.1.66644 WP_000339804.1.6665 WP_000339804.1.6666 WP_000339804.1.66667 WP_000339804.1.66700 WP_000339804.1.66706 WP_000339804.1.66708 WP_000339804.1.66719 WP_000339804.1.66727 WP_000339804.1.66758 WP_000339804.1.66783 WP_000339804.1.66787 WP_000339804.1.66791 WP_000339804.1.66795 WP_000339804.1.66796 WP_000339804.1.66849 WP_000339804.1.66926 WP_000339804.1.66933 WP_000339804.1.66948 WP_000339804.1.66975 WP_000339804.1.6698 WP_000339804.1.66984 WP_000339804.1.67018 WP_000339804.1.67022 WP_000339804.1.67026 WP_000339804.1.67102 WP_000339804.1.67116 WP_000339804.1.67132 WP_000339804.1.67149 WP_000339804.1.67153 WP_000339804.1.67158 WP_000339804.1.67164 WP_000339804.1.67174 WP_000339804.1.67193 WP_000339804.1.67194 WP_000339804.1.67210 WP_000339804.1.6723 WP_000339804.1.67258 WP_000339804.1.67272 WP_000339804.1.67284 WP_000339804.1.67293 WP_000339804.1.6735 WP_000339804.1.67373 WP_000339804.1.67383 WP_000339804.1.67415 WP_000339804.1.67427 WP_000339804.1.67451 WP_000339804.1.67454 WP_000339804.1.67462 WP_000339804.1.67464 WP_000339804.1.67467 WP_000339804.1.67468 WP_000339804.1.67495 WP_000339804.1.67522 WP_000339804.1.67538 WP_000339804.1.67549 WP_000339804.1.67553 WP_000339804.1.67581 WP_000339804.1.67606 WP_000339804.1.67663 WP_000339804.1.67669 WP_000339804.1.67681 WP_000339804.1.67685 WP_000339804.1.67690 WP_000339804.1.67701 WP_000339804.1.67704 WP_000339804.1.67724 WP_000339804.1.67737 WP_000339804.1.67758 WP_000339804.1.67760 WP_000339804.1.67786 WP_000339804.1.67787 WP_000339804.1.67788 WP_000339804.1.678 WP_000339804.1.67841 WP_000339804.1.67853 WP_000339804.1.67861 WP_000339804.1.67891 WP_000339804.1.67894 WP_000339804.1.67901 WP_000339804.1.67938 WP_000339804.1.67971 WP_000339804.1.67975 WP_000339804.1.67984 WP_000339804.1.67990 WP_000339804.1.67999 WP_000339804.1.68008 WP_000339804.1.68011 WP_000339804.1.68012 WP_000339804.1.6802 WP_000339804.1.68025 WP_000339804.1.6803 WP_000339804.1.68039 WP_000339804.1.68052 WP_000339804.1.68053 WP_000339804.1.68058 WP_000339804.1.68059 WP_000339804.1.68069 WP_000339804.1.68071 WP_000339804.1.68079 WP_000339804.1.68108 WP_000339804.1.68126 WP_000339804.1.6814 WP_000339804.1.68145 WP_000339804.1.68157 WP_000339804.1.68170 WP_000339804.1.68177 WP_000339804.1.68215 WP_000339804.1.68231 WP_000339804.1.68241 WP_000339804.1.68255 WP_000339804.1.68281 WP_000339804.1.68292 WP_000339804.1.68336 WP_000339804.1.68341 WP_000339804.1.68347 WP_000339804.1.68362 WP_000339804.1.68369 WP_000339804.1.68372 WP_000339804.1.68441 WP_000339804.1.68442 WP_000339804.1.68482 WP_000339804.1.68490 WP_000339804.1.68524 WP_000339804.1.68566 WP_000339804.1.68572 WP_000339804.1.68584 WP_000339804.1.6859 WP_000339804.1.68598 WP_000339804.1.6860 WP_000339804.1.68630 WP_000339804.1.68632 WP_000339804.1.68635 WP_000339804.1.68673 WP_000339804.1.68678 WP_000339804.1.68679 WP_000339804.1.68695 WP_000339804.1.68697 WP_000339804.1.68701 WP_000339804.1.68711 WP_000339804.1.68735 WP_000339804.1.68751 WP_000339804.1.68752 WP_000339804.1.6877 WP_000339804.1.68793 WP_000339804.1.68795 WP_000339804.1.68797 WP_000339804.1.68801 WP_000339804.1.68838 WP_000339804.1.68847 WP_000339804.1.68865 WP_000339804.1.68873 WP_000339804.1.68877 WP_000339804.1.68880 WP_000339804.1.68911 WP_000339804.1.68915 WP_000339804.1.68942 WP_000339804.1.68952 WP_000339804.1.68956 WP_000339804.1.68961 WP_000339804.1.68989 WP_000339804.1.68995 WP_000339804.1.69033 WP_000339804.1.69039 WP_000339804.1.69098 WP_000339804.1.69126 WP_000339804.1.69127 WP_000339804.1.6916 WP_000339804.1.6919 WP_000339804.1.69192 WP_000339804.1.69261 WP_000339804.1.6929 WP_000339804.1.69303 WP_000339804.1.69305 WP_000339804.1.69327 WP_000339804.1.69382 WP_000339804.1.69390 WP_000339804.1.694 WP_000339804.1.69441 WP_000339804.1.69450 WP_000339804.1.69472 WP_000339804.1.69473 WP_000339804.1.69502 WP_000339804.1.69537 WP_000339804.1.69551 WP_000339804.1.69589 WP_000339804.1.69593 WP_000339804.1.69596 WP_000339804.1.69643 WP_000339804.1.69646 WP_000339804.1.69655 WP_000339804.1.69689 WP_000339804.1.697 WP_000339804.1.69716 WP_000339804.1.69730 WP_000339804.1.69735 WP_000339804.1.69832 WP_000339804.1.69887 WP_000339804.1.69963 WP_000339804.1.69972 WP_000339804.1.69979 WP_000339804.1.69999 WP_000339804.1.7001 WP_000339804.1.70063 WP_000339804.1.70081 WP_000339804.1.701 WP_000339804.1.70149 WP_000339804.1.7015 WP_000339804.1.70190 WP_000339804.1.70200 WP_000339804.1.70213 WP_000339804.1.70230 WP_000339804.1.70256 WP_000339804.1.70300 WP_000339804.1.70357 WP_000339804.1.70386 WP_000339804.1.70407 WP_000339804.1.70408 WP_000339804.1.70414 WP_000339804.1.70477 WP_000339804.1.70492 WP_000339804.1.7050 WP_000339804.1.70509 WP_000339804.1.70563 WP_000339804.1.70578 WP_000339804.1.70582 WP_000339804.1.70592 WP_000339804.1.70600 WP_000339804.1.70619 WP_000339804.1.70628 WP_000339804.1.70655 WP_000339804.1.70686 WP_000339804.1.70698 WP_000339804.1.70705 WP_000339804.1.70728 WP_000339804.1.70745 WP_000339804.1.70747 WP_000339804.1.70748 WP_000339804.1.70767 WP_000339804.1.70794 WP_000339804.1.70803 WP_000339804.1.70880 WP_000339804.1.7090 WP_000339804.1.70900 WP_000339804.1.70952 WP_000339804.1.70967 WP_000339804.1.71024 WP_000339804.1.71037 WP_000339804.1.71042 WP_000339804.1.71062 WP_000339804.1.71109 WP_000339804.1.71134 WP_000339804.1.71139 WP_000339804.1.71147 WP_000339804.1.71159 WP_000339804.1.71162 WP_000339804.1.71170 WP_000339804.1.71176 WP_000339804.1.71183 WP_000339804.1.71192 WP_000339804.1.71199 WP_000339804.1.7121 WP_000339804.1.71221 WP_000339804.1.71223 WP_000339804.1.71229 WP_000339804.1.71264 WP_000339804.1.71272 WP_000339804.1.71273 WP_000339804.1.71275 WP_000339804.1.71287 WP_000339804.1.71294 WP_000339804.1.71311 WP_000339804.1.71312 WP_000339804.1.71315 WP_000339804.1.71323 WP_000339804.1.71339 WP_000339804.1.71354 WP_000339804.1.71397 WP_000339804.1.71403 WP_000339804.1.7147 WP_000339804.1.71480 WP_000339804.1.71522 WP_000339804.1.71533 WP_000339804.1.71537 WP_000339804.1.71538 WP_000339804.1.71540 WP_000339804.1.71560 WP_000339804.1.71562 WP_000339804.1.71563 WP_000339804.1.71603 WP_000339804.1.71607 WP_000339804.1.71680 WP_000339804.1.71690 WP_000339804.1.71695 WP_000339804.1.71712 WP_000339804.1.71732 WP_000339804.1.71757 WP_000339804.1.71830 WP_000339804.1.71832 WP_000339804.1.71837 WP_000339804.1.71855 WP_000339804.1.71856 WP_000339804.1.71874 WP_000339804.1.7192 WP_000339804.1.71922 WP_000339804.1.71938 WP_000339804.1.71944 WP_000339804.1.71945 WP_000339804.1.71967 WP_000339804.1.71972 WP_000339804.1.71975 WP_000339804.1.71987 WP_000339804.1.71993 WP_000339804.1.71995 WP_000339804.1.72013 WP_000339804.1.72021 WP_000339804.1.72028 WP_000339804.1.72033 WP_000339804.1.72048 WP_000339804.1.7205 WP_000339804.1.72054 WP_000339804.1.72066 WP_000339804.1.72090 WP_000339804.1.72098 WP_000339804.1.7210 WP_000339804.1.72117 WP_000339804.1.72120 WP_000339804.1.72125 WP_000339804.1.72126 WP_000339804.1.72141 WP_000339804.1.72153 WP_000339804.1.72155 WP_000339804.1.72157 WP_000339804.1.72162 WP_000339804.1.72184 WP_000339804.1.72186 WP_000339804.1.72212 WP_000339804.1.72237 WP_000339804.1.7225 WP_000339804.1.72258 WP_000339804.1.72262 WP_000339804.1.72270 WP_000339804.1.72279 WP_000339804.1.72290 WP_000339804.1.72293 WP_000339804.1.723 WP_000339804.1.72316 WP_000339804.1.72337 WP_000339804.1.72359 WP_000339804.1.72362 WP_000339804.1.72388 WP_000339804.1.72391 WP_000339804.1.72392 WP_000339804.1.72397 WP_000339804.1.72414 WP_000339804.1.72425 WP_000339804.1.72431 WP_000339804.1.72436 WP_000339804.1.72469 WP_000339804.1.72485 WP_000339804.1.72493 WP_000339804.1.72507 WP_000339804.1.72511 WP_000339804.1.72522 WP_000339804.1.72537 WP_000339804.1.72551 WP_000339804.1.72574 WP_000339804.1.72588 WP_000339804.1.72593 WP_000339804.1.72596 WP_000339804.1.72599 WP_000339804.1.72608 WP_000339804.1.72615 WP_000339804.1.72616 WP_000339804.1.72643 WP_000339804.1.72651 WP_000339804.1.72652 WP_000339804.1.72663 WP_000339804.1.72695 WP_000339804.1.72700 WP_000339804.1.72706 WP_000339804.1.72725 WP_000339804.1.72729 WP_000339804.1.72738 WP_000339804.1.72745 WP_000339804.1.72751 WP_000339804.1.72758 WP_000339804.1.72764 WP_000339804.1.7277 WP_000339804.1.72778 WP_000339804.1.72804 WP_000339804.1.72806 WP_000339804.1.7281 WP_000339804.1.72837 WP_000339804.1.72857 WP_000339804.1.72858 WP_000339804.1.72860 WP_000339804.1.72869 WP_000339804.1.72910 WP_000339804.1.72947 WP_000339804.1.72950 WP_000339804.1.72956 WP_000339804.1.72962 WP_000339804.1.72998 WP_000339804.1.73010 WP_000339804.1.73015 WP_000339804.1.73032 WP_000339804.1.73039 WP_000339804.1.7307 WP_000339804.1.73072 WP_000339804.1.73085 WP_000339804.1.7309 WP_000339804.1.73094 WP_000339804.1.73197 WP_000339804.1.73215 WP_000339804.1.73217 WP_000339804.1.73230 WP_000339804.1.73239 WP_000339804.1.73249 WP_000339804.1.73251 WP_000339804.1.73257 WP_000339804.1.73259 WP_000339804.1.73278 WP_000339804.1.73291 WP_000339804.1.73292 WP_000339804.1.73295 WP_000339804.1.73326 WP_000339804.1.73340 WP_000339804.1.73344 WP_000339804.1.73349 WP_000339804.1.73385 WP_000339804.1.73393 WP_000339804.1.73428 WP_000339804.1.73468 WP_000339804.1.73486 WP_000339804.1.7349 WP_000339804.1.73498 WP_000339804.1.73524 WP_000339804.1.73565 WP_000339804.1.73572 WP_000339804.1.73592 WP_000339804.1.73604 WP_000339804.1.73631 WP_000339804.1.73652 WP_000339804.1.73700 WP_000339804.1.73709 WP_000339804.1.73743 WP_000339804.1.73748 WP_000339804.1.73783 WP_000339804.1.73797 WP_000339804.1.73811 WP_000339804.1.73835 WP_000339804.1.73843 WP_000339804.1.73844 WP_000339804.1.73859 WP_000339804.1.73897 WP_000339804.1.73908 WP_000339804.1.73942 WP_000339804.1.73992 WP_000339804.1.73995 WP_000339804.1.73996 WP_000339804.1.74032 WP_000339804.1.74041 WP_000339804.1.74051 WP_000339804.1.74053 WP_000339804.1.7407 WP_000339804.1.7411 WP_000339804.1.74123 WP_000339804.1.7413 WP_000339804.1.74156 WP_000339804.1.74213 WP_000339804.1.74223 WP_000339804.1.7424 WP_000339804.1.74243 WP_000339804.1.74294 WP_000339804.1.74309 WP_000339804.1.74365 WP_000339804.1.744 WP_000339804.1.74423 WP_000339804.1.74431 WP_000339804.1.74444 WP_000339804.1.74445 WP_000339804.1.74465 WP_000339804.1.74478 WP_000339804.1.74491 WP_000339804.1.74501 WP_000339804.1.74513 WP_000339804.1.74528 WP_000339804.1.74532 WP_000339804.1.74574 WP_000339804.1.7461 WP_000339804.1.74623 WP_000339804.1.74624 WP_000339804.1.74625 WP_000339804.1.74652 WP_000339804.1.74670 WP_000339804.1.74682 WP_000339804.1.74687 WP_000339804.1.74688 WP_000339804.1.74689 WP_000339804.1.74691 WP_000339804.1.74705 WP_000339804.1.7471 WP_000339804.1.74716 WP_000339804.1.74720 WP_000339804.1.74735 WP_000339804.1.7475 WP_000339804.1.74752 WP_000339804.1.74765 WP_000339804.1.74767 WP_000339804.1.7478 WP_000339804.1.7479 WP_000339804.1.74793 WP_000339804.1.74811 WP_000339804.1.74844 WP_000339804.1.74852 WP_000339804.1.74854 WP_000339804.1.74867 WP_000339804.1.74873 WP_000339804.1.74879 WP_000339804.1.74885 WP_000339804.1.74895 WP_000339804.1.74914 WP_000339804.1.74915 WP_000339804.1.74962 WP_000339804.1.74975 WP_000339804.1.74993 WP_000339804.1.74998 WP_000339804.1.75003 WP_000339804.1.75021 WP_000339804.1.75029 WP_000339804.1.75050 WP_000339804.1.75087 WP_000339804.1.75100 WP_000339804.1.75112 WP_000339804.1.75118 WP_000339804.1.75136 WP_000339804.1.75138 WP_000339804.1.75139 WP_000339804.1.75143 WP_000339804.1.75145 WP_000339804.1.75149 WP_000339804.1.75155 WP_000339804.1.7516 WP_000339804.1.75181 WP_000339804.1.75209 WP_000339804.1.75219 WP_000339804.1.75221 WP_000339804.1.75228 WP_000339804.1.75243 WP_000339804.1.75247 WP_000339804.1.75254 WP_000339804.1.75270 WP_000339804.1.75360 WP_000339804.1.75419 WP_000339804.1.75435 WP_000339804.1.75491 WP_000339804.1.75529 WP_000339804.1.75557 WP_000339804.1.75568 WP_000339804.1.75588 WP_000339804.1.75594 WP_000339804.1.75602 WP_000339804.1.75612 WP_000339804.1.75629 WP_000339804.1.75644 WP_000339804.1.75679 WP_000339804.1.75687 WP_000339804.1.75696 WP_000339804.1.75698 WP_000339804.1.75699 WP_000339804.1.75758 WP_000339804.1.75803 WP_000339804.1.75808 WP_000339804.1.75853 WP_000339804.1.75892 WP_000339804.1.75922 WP_000339804.1.7597 WP_000339804.1.75973 WP_000339804.1.75983 WP_000339804.1.75995 WP_000339804.1.75999 WP_000339804.1.76005 WP_000339804.1.7603 WP_000339804.1.76030 WP_000339804.1.76036 WP_000339804.1.76039 WP_000339804.1.76057 WP_000339804.1.76087 WP_000339804.1.76089 WP_000339804.1.76103 WP_000339804.1.76118 WP_000339804.1.76129 WP_000339804.1.7613 WP_000339804.1.7617 WP_000339804.1.76194 WP_000339804.1.76196 WP_000339804.1.76268 WP_000339804.1.76269 WP_000339804.1.76312 WP_000339804.1.76325 WP_000339804.1.76335 WP_000339804.1.76361 WP_000339804.1.7637 WP_000339804.1.76384 WP_000339804.1.76390 WP_000339804.1.76446 WP_000339804.1.76452 WP_000339804.1.76462 WP_000339804.1.76466 WP_000339804.1.76469 WP_000339804.1.76504 WP_000339804.1.76542 WP_000339804.1.76544 WP_000339804.1.76595 WP_000339804.1.76596 WP_000339804.1.7661 WP_000339804.1.76612 WP_000339804.1.76619 WP_000339804.1.76643 WP_000339804.1.76656 WP_000339804.1.76660 WP_000339804.1.76701 WP_000339804.1.76705 WP_000339804.1.76815 WP_000339804.1.76840 WP_000339804.1.76863 WP_000339804.1.76884 WP_000339804.1.7689 WP_000339804.1.76909 WP_000339804.1.76918 WP_000339804.1.76933 WP_000339804.1.76961 WP_000339804.1.76965 WP_000339804.1.76966 WP_000339804.1.7699 WP_000339804.1.77007 WP_000339804.1.77015 WP_000339804.1.77022 WP_000339804.1.77036 WP_000339804.1.77042 WP_000339804.1.77057 WP_000339804.1.77070 WP_000339804.1.77081 WP_000339804.1.771 WP_000339804.1.77109 WP_000339804.1.77120 WP_000339804.1.77147 WP_000339804.1.77162 WP_000339804.1.77163 WP_000339804.1.77173 WP_000339804.1.77175 WP_000339804.1.77200 WP_000339804.1.77204 WP_000339804.1.77214 WP_000339804.1.77224 WP_000339804.1.77255 WP_000339804.1.77258 WP_000339804.1.7728 WP_000339804.1.77284 WP_000339804.1.77288 WP_000339804.1.77291 WP_000339804.1.7731 WP_000339804.1.77320 WP_000339804.1.77326 WP_000339804.1.77341 WP_000339804.1.77391 WP_000339804.1.77408 WP_000339804.1.77419 WP_000339804.1.77437 WP_000339804.1.77448 WP_000339804.1.77452 WP_000339804.1.77462 WP_000339804.1.7747 WP_000339804.1.77470 WP_000339804.1.77477 WP_000339804.1.77487 WP_000339804.1.77495 WP_000339804.1.775 WP_000339804.1.77503 WP_000339804.1.77511 WP_000339804.1.77542 WP_000339804.1.77551 WP_000339804.1.7756 WP_000339804.1.77581 WP_000339804.1.77595 WP_000339804.1.77600 WP_000339804.1.77626 WP_000339804.1.77643 WP_000339804.1.77648 WP_000339804.1.77725 WP_000339804.1.77741 WP_000339804.1.7775 WP_000339804.1.77767 WP_000339804.1.77768 WP_000339804.1.7780 WP_000339804.1.7781 WP_000339804.1.77816 WP_000339804.1.77826 WP_000339804.1.77833 WP_000339804.1.77876 WP_000339804.1.77929 WP_000339804.1.77949 WP_000339804.1.7795 WP_000339804.1.77950 WP_000339804.1.77999 WP_000339804.1.78000 WP_000339804.1.78007 WP_000339804.1.78010 WP_000339804.1.7804 WP_000339804.1.78059 WP_000339804.1.7806 WP_000339804.1.7808 WP_000339804.1.78089 WP_000339804.1.78097 WP_000339804.1.78099 WP_000339804.1.78101 WP_000339804.1.78102 WP_000339804.1.78183 WP_000339804.1.78187 WP_000339804.1.78188 WP_000339804.1.78196 WP_000339804.1.78232 WP_000339804.1.78235 WP_000339804.1.78297 WP_000339804.1.78305 WP_000339804.1.78321 WP_000339804.1.78340 WP_000339804.1.78376 WP_000339804.1.78390 WP_000339804.1.78413 WP_000339804.1.78445 WP_000339804.1.78462 WP_000339804.1.78463 WP_000339804.1.7847 WP_000339804.1.78491 WP_000339804.1.7851 WP_000339804.1.78512 WP_000339804.1.78553 WP_000339804.1.78575 WP_000339804.1.78583 WP_000339804.1.78586 WP_000339804.1.78610 WP_000339804.1.78612 WP_000339804.1.78645 WP_000339804.1.78677 WP_000339804.1.78683 WP_000339804.1.78687 WP_000339804.1.78689 WP_000339804.1.78696 WP_000339804.1.78698 WP_000339804.1.78706 WP_000339804.1.78714 WP_000339804.1.78718 WP_000339804.1.78746 WP_000339804.1.78750 WP_000339804.1.78757 WP_000339804.1.78773 WP_000339804.1.78814 WP_000339804.1.7883 WP_000339804.1.78843 WP_000339804.1.78845 WP_000339804.1.78854 WP_000339804.1.78891 WP_000339804.1.78893 WP_000339804.1.78895 WP_000339804.1.78908 WP_000339804.1.78919 WP_000339804.1.78953 WP_000339804.1.78955 WP_000339804.1.7896 WP_000339804.1.7898 WP_000339804.1.79001 WP_000339804.1.79002 WP_000339804.1.79004 WP_000339804.1.7901 WP_000339804.1.79065 WP_000339804.1.79067 WP_000339804.1.79075 WP_000339804.1.79086 WP_000339804.1.79088 WP_000339804.1.79090 WP_000339804.1.79092 WP_000339804.1.79100 WP_000339804.1.79137 WP_000339804.1.79226 WP_000339804.1.79243 WP_000339804.1.79246 WP_000339804.1.79276 WP_000339804.1.79308 WP_000339804.1.79312 WP_000339804.1.79346 WP_000339804.1.79356 WP_000339804.1.79365 WP_000339804.1.79369 WP_000339804.1.79409 WP_000339804.1.79414 WP_000339804.1.79416 WP_000339804.1.79505 WP_000339804.1.79519 WP_000339804.1.79525 WP_000339804.1.79540 WP_000339804.1.79558 WP_000339804.1.79591 WP_000339804.1.79606 WP_000339804.1.79619 WP_000339804.1.79707 WP_000339804.1.79713 WP_000339804.1.79764 WP_000339804.1.79800 WP_000339804.1.79816 WP_000339804.1.79824 WP_000339804.1.79840 WP_000339804.1.7985 WP_000339804.1.79866 WP_000339804.1.79869 WP_000339804.1.7987 WP_000339804.1.79871 WP_000339804.1.79877 WP_000339804.1.79905 WP_000339804.1.7993 WP_000339804.1.79930 WP_000339804.1.79931 WP_000339804.1.79932 WP_000339804.1.79933 WP_000339804.1.79936 WP_000339804.1.79944 WP_000339804.1.79955 WP_000339804.1.79973 WP_000339804.1.79984 WP_000339804.1.80 WP_000339804.1.80011 WP_000339804.1.80016 WP_000339804.1.80026 WP_000339804.1.80043 WP_000339804.1.80050 WP_000339804.1.80060 WP_000339804.1.80063 WP_000339804.1.80071 WP_000339804.1.80096 WP_000339804.1.80106 WP_000339804.1.8011 WP_000339804.1.80112 WP_000339804.1.80136 WP_000339804.1.80176 WP_000339804.1.80179 WP_000339804.1.80183 WP_000339804.1.80192 WP_000339804.1.80255 WP_000339804.1.80292 WP_000339804.1.80310 WP_000339804.1.80320 WP_000339804.1.80343 WP_000339804.1.80388 WP_000339804.1.80392 WP_000339804.1.804 WP_000339804.1.80402 WP_000339804.1.80426 WP_000339804.1.80428 WP_000339804.1.80440 WP_000339804.1.80456 WP_000339804.1.80484 WP_000339804.1.80519 WP_000339804.1.80524 WP_000339804.1.80545 WP_000339804.1.80558 WP_000339804.1.80559 WP_000339804.1.8057 WP_000339804.1.80577 WP_000339804.1.80594 WP_000339804.1.80626 WP_000339804.1.80660 WP_000339804.1.80662 WP_000339804.1.80666 WP_000339804.1.80676 WP_000339804.1.80709 WP_000339804.1.80731 WP_000339804.1.80736 WP_000339804.1.80737 WP_000339804.1.8074 WP_000339804.1.80754 WP_000339804.1.80756 WP_000339804.1.8076 WP_000339804.1.80768 WP_000339804.1.80789 WP_000339804.1.808 WP_000339804.1.80804 WP_000339804.1.80843 WP_000339804.1.80882 WP_000339804.1.80894 WP_000339804.1.8090 WP_000339804.1.8091 WP_000339804.1.80945 WP_000339804.1.80946 WP_000339804.1.80948 WP_000339804.1.80954 WP_000339804.1.80983 WP_000339804.1.80985 WP_000339804.1.81026 WP_000339804.1.81032 WP_000339804.1.81034 WP_000339804.1.81036 WP_000339804.1.81054 WP_000339804.1.81056 WP_000339804.1.81071 WP_000339804.1.81098 WP_000339804.1.811 WP_000339804.1.81104 WP_000339804.1.81120 WP_000339804.1.81141 WP_000339804.1.81165 WP_000339804.1.81180 WP_000339804.1.81186 WP_000339804.1.8121 WP_000339804.1.81219 WP_000339804.1.81266 WP_000339804.1.81281 WP_000339804.1.81283 WP_000339804.1.81286 WP_000339804.1.8129 WP_000339804.1.81298 WP_000339804.1.81313 WP_000339804.1.81316 WP_000339804.1.81323 WP_000339804.1.81347 WP_000339804.1.81396 WP_000339804.1.814 WP_000339804.1.81418 WP_000339804.1.81438 WP_000339804.1.81469 WP_000339804.1.81475 WP_000339804.1.8156 WP_000339804.1.81577 WP_000339804.1.81580 WP_000339804.1.81588 WP_000339804.1.81596 WP_000339804.1.81602 WP_000339804.1.81618 WP_000339804.1.81624 WP_000339804.1.81688 WP_000339804.1.81692 WP_000339804.1.81715 WP_000339804.1.81723 WP_000339804.1.81806 WP_000339804.1.81819 WP_000339804.1.81832 WP_000339804.1.81869 WP_000339804.1.81881 WP_000339804.1.81939 WP_000339804.1.81952 WP_000339804.1.81972 WP_000339804.1.82 WP_000339804.1.82008 WP_000339804.1.82032 WP_000339804.1.82061 WP_000339804.1.82062 WP_000339804.1.82074 WP_000339804.1.82095 WP_000339804.1.82104 WP_000339804.1.82106 WP_000339804.1.82116 WP_000339804.1.82123 WP_000339804.1.82137 WP_000339804.1.82166 WP_000339804.1.82217 WP_000339804.1.82221 WP_000339804.1.82239 WP_000339804.1.82242 WP_000339804.1.82246 WP_000339804.1.82280 WP_000339804.1.82316 WP_000339804.1.82320 WP_000339804.1.82326 WP_000339804.1.82330 WP_000339804.1.8235 WP_000339804.1.82378 WP_000339804.1.82438 WP_000339804.1.82439 WP_000339804.1.82485 WP_000339804.1.82499 WP_000339804.1.82527 WP_000339804.1.82536 WP_000339804.1.8255 WP_000339804.1.82589 WP_000339804.1.82614 WP_000339804.1.82626 WP_000339804.1.82647 WP_000339804.1.82661 WP_000339804.1.82682 WP_000339804.1.82691 WP_000339804.1.82700 WP_000339804.1.82705 WP_000339804.1.82711 WP_000339804.1.82715 WP_000339804.1.82747 WP_000339804.1.82754 WP_000339804.1.8277 WP_000339804.1.82780 WP_000339804.1.82799 WP_000339804.1.82816 WP_000339804.1.82831 WP_000339804.1.82833 WP_000339804.1.8295 WP_000339804.1.82991 WP_000339804.1.83020 WP_000339804.1.83033 WP_000339804.1.83035 WP_000339804.1.83036 WP_000339804.1.83051 WP_000339804.1.83059 WP_000339804.1.8306 WP_000339804.1.8308 WP_000339804.1.83093 WP_000339804.1.831 WP_000339804.1.83118 WP_000339804.1.83125 WP_000339804.1.83127 WP_000339804.1.83140 WP_000339804.1.83144 WP_000339804.1.83160 WP_000339804.1.83177 WP_000339804.1.83205 WP_000339804.1.83218 WP_000339804.1.83224 WP_000339804.1.83253 WP_000339804.1.83256 WP_000339804.1.83313 WP_000339804.1.83330 WP_000339804.1.83375 WP_000339804.1.83393 WP_000339804.1.83466 WP_000339804.1.83506 WP_000339804.1.83537 WP_000339804.1.83544 WP_000339804.1.83564 WP_000339804.1.83582 WP_000339804.1.83584 WP_000339804.1.83644 WP_000339804.1.83668 WP_000339804.1.83684 WP_000339804.1.83706 WP_000339804.1.83735 WP_000339804.1.83781 WP_000339804.1.83807 WP_000339804.1.83820 WP_000339804.1.8386 WP_000339804.1.83911 WP_000339804.1.83936 WP_000339804.1.83941 WP_000339804.1.83947 WP_000339804.1.84004 WP_000339804.1.84014 WP_000339804.1.84021 WP_000339804.1.8405 WP_000339804.1.84060 WP_000339804.1.84074 WP_000339804.1.8408 WP_000339804.1.8411 WP_000339804.1.84185 WP_000339804.1.84197 WP_000339804.1.84215 WP_000339804.1.84313 WP_000339804.1.84316 WP_000339804.1.84326 WP_000339804.1.84331 WP_000339804.1.84348 WP_000339804.1.84405 WP_000339804.1.84410 WP_000339804.1.84436 WP_000339804.1.8444 WP_000339804.1.84462 WP_000339804.1.84464 WP_000339804.1.8447 WP_000339804.1.84473 WP_000339804.1.84484 WP_000339804.1.84486 WP_000339804.1.84511 WP_000339804.1.84518 WP_000339804.1.84531 WP_000339804.1.84534 WP_000339804.1.84584 WP_000339804.1.84639 WP_000339804.1.84656 WP_000339804.1.84668 WP_000339804.1.84675 WP_000339804.1.84697 WP_000339804.1.8470 WP_000339804.1.84738 WP_000339804.1.84740 WP_000339804.1.84768 WP_000339804.1.84797 WP_000339804.1.84841 WP_000339804.1.84875 WP_000339804.1.84878 WP_000339804.1.84893 WP_000339804.1.84894 WP_000339804.1.84916 WP_000339804.1.84929 WP_000339804.1.84941 WP_000339804.1.84948 WP_000339804.1.84977 WP_000339804.1.84989 WP_000339804.1.84994 WP_000339804.1.85002 WP_000339804.1.85011 WP_000339804.1.85025 WP_000339804.1.85052 WP_000339804.1.85085 WP_000339804.1.85090 WP_000339804.1.85098 WP_000339804.1.85105 WP_000339804.1.85129 WP_000339804.1.85138 WP_000339804.1.85141 WP_000339804.1.85155 WP_000339804.1.85156 WP_000339804.1.85175 WP_000339804.1.85216 WP_000339804.1.85247 WP_000339804.1.85252 WP_000339804.1.85255 WP_000339804.1.85260 WP_000339804.1.8530 WP_000339804.1.85305 WP_000339804.1.85310 WP_000339804.1.85323 WP_000339804.1.85329 WP_000339804.1.85335 WP_000339804.1.85342 WP_000339804.1.85369 WP_000339804.1.85385 WP_000339804.1.85500 WP_000339804.1.85525 WP_000339804.1.85546 WP_000339804.1.85556 WP_000339804.1.85563 WP_000339804.1.85578 WP_000339804.1.85593 WP_000339804.1.85601 WP_000339804.1.85621 WP_000339804.1.85623 WP_000339804.1.85657 WP_000339804.1.85685 WP_000339804.1.85752 WP_000339804.1.85762 WP_000339804.1.85767 WP_000339804.1.85781 WP_000339804.1.8579 WP_000339804.1.85793 WP_000339804.1.85800 WP_000339804.1.85806 WP_000339804.1.85895 WP_000339804.1.85939 WP_000339804.1.85944 WP_000339804.1.85948 WP_000339804.1.86 WP_000339804.1.86001 WP_000339804.1.86016 WP_000339804.1.86035 WP_000339804.1.86063 WP_000339804.1.8607 WP_000339804.1.86104 WP_000339804.1.86115 WP_000339804.1.86145 WP_000339804.1.86149 WP_000339804.1.86166 WP_000339804.1.86179 WP_000339804.1.86181 WP_000339804.1.86196 WP_000339804.1.8621 WP_000339804.1.86210 WP_000339804.1.86261 WP_000339804.1.86263 WP_000339804.1.86266 WP_000339804.1.86273 WP_000339804.1.86280 WP_000339804.1.86283 WP_000339804.1.86294 WP_000339804.1.86307 WP_000339804.1.8635 WP_000339804.1.86355 WP_000339804.1.86371 WP_000339804.1.86393 WP_000339804.1.86411 WP_000339804.1.86412 WP_000339804.1.86452 WP_000339804.1.86454 WP_000339804.1.86461 WP_000339804.1.86475 WP_000339804.1.86492 WP_000339804.1.86518 WP_000339804.1.8652 WP_000339804.1.8656 WP_000339804.1.86560 WP_000339804.1.86583 WP_000339804.1.86586 WP_000339804.1.86598 WP_000339804.1.86609 WP_000339804.1.86613 WP_000339804.1.86617 WP_000339804.1.86640 WP_000339804.1.86667 WP_000339804.1.86673 WP_000339804.1.86674 WP_000339804.1.86691 WP_000339804.1.86707 WP_000339804.1.86727 WP_000339804.1.86833 WP_000339804.1.86846 WP_000339804.1.86935 WP_000339804.1.86956 WP_000339804.1.86959 WP_000339804.1.86975 WP_000339804.1.86997 WP_000339804.1.87043 WP_000339804.1.8705 WP_000339804.1.87059 WP_000339804.1.87075 WP_000339804.1.87102 WP_000339804.1.87109 WP_000339804.1.87177 WP_000339804.1.87189 WP_000339804.1.87199 WP_000339804.1.87205 WP_000339804.1.87249 WP_000339804.1.87310 WP_000339804.1.87339 WP_000339804.1.87358 WP_000339804.1.87371 WP_000339804.1.87389 WP_000339804.1.87400 WP_000339804.1.87443 WP_000339804.1.87465 WP_000339804.1.87491 WP_000339804.1.87504 WP_000339804.1.87557 WP_000339804.1.87574 WP_000339804.1.87581 WP_000339804.1.87590 WP_000339804.1.87608 WP_000339804.1.87633 WP_000339804.1.87639 WP_000339804.1.87655 WP_000339804.1.87675 WP_000339804.1.87694 WP_000339804.1.87696 WP_000339804.1.8771 WP_000339804.1.87721 WP_000339804.1.87726 WP_000339804.1.87728 WP_000339804.1.87738 WP_000339804.1.87766 WP_000339804.1.8778 WP_000339804.1.87786 WP_000339804.1.87788 WP_000339804.1.87789 WP_000339804.1.87834 WP_000339804.1.87857 WP_000339804.1.87883 WP_000339804.1.87914 WP_000339804.1.87919 WP_000339804.1.87973 WP_000339804.1.87976 WP_000339804.1.87980 WP_000339804.1.87984 WP_000339804.1.87989 WP_000339804.1.87990 WP_000339804.1.880 WP_000339804.1.88017 WP_000339804.1.88020 WP_000339804.1.88066 WP_000339804.1.8807 WP_000339804.1.88082 WP_000339804.1.88088 WP_000339804.1.88110 WP_000339804.1.88119 WP_000339804.1.88149 WP_000339804.1.88155 WP_000339804.1.88189 WP_000339804.1.8822 WP_000339804.1.88234 WP_000339804.1.88238 WP_000339804.1.88252 WP_000339804.1.88260 WP_000339804.1.88285 WP_000339804.1.88304 WP_000339804.1.88336 WP_000339804.1.88352 WP_000339804.1.88376 WP_000339804.1.88379 WP_000339804.1.88384 WP_000339804.1.88413 WP_000339804.1.88427 WP_000339804.1.88434 WP_000339804.1.88438 WP_000339804.1.88467 WP_000339804.1.8848 WP_000339804.1.88499 WP_000339804.1.88539 WP_000339804.1.8854 WP_000339804.1.8855 WP_000339804.1.88562 WP_000339804.1.88577 WP_000339804.1.88603 WP_000339804.1.88607 WP_000339804.1.88631 WP_000339804.1.88667 WP_000339804.1.88678 WP_000339804.1.88685 WP_000339804.1.88709 WP_000339804.1.88720 WP_000339804.1.88729 WP_000339804.1.88732 WP_000339804.1.88752 WP_000339804.1.88757 WP_000339804.1.88759 WP_000339804.1.88767 WP_000339804.1.8879 WP_000339804.1.88793 WP_000339804.1.88834 WP_000339804.1.88864 WP_000339804.1.88880 WP_000339804.1.88883 WP_000339804.1.88941 WP_000339804.1.88961 WP_000339804.1.88997 WP_000339804.1.89018 WP_000339804.1.89043 WP_000339804.1.89050 WP_000339804.1.8906 WP_000339804.1.89090 WP_000339804.1.89097 WP_000339804.1.89099 WP_000339804.1.89111 WP_000339804.1.89150 WP_000339804.1.89183 WP_000339804.1.89197 WP_000339804.1.89200 WP_000339804.1.89203 WP_000339804.1.89217 WP_000339804.1.89255 WP_000339804.1.8928 WP_000339804.1.89285 WP_000339804.1.89305 WP_000339804.1.89312 WP_000339804.1.89334 WP_000339804.1.89335 WP_000339804.1.89379 WP_000339804.1.8938 WP_000339804.1.89396 WP_000339804.1.89400 WP_000339804.1.89403 WP_000339804.1.89416 WP_000339804.1.89427 WP_000339804.1.89432 WP_000339804.1.8945 WP_000339804.1.89455 WP_000339804.1.89458 WP_000339804.1.89468 WP_000339804.1.89469 WP_000339804.1.89474 WP_000339804.1.89479 WP_000339804.1.89492 WP_000339804.1.89510 WP_000339804.1.89601 WP_000339804.1.89605 WP_000339804.1.89627 WP_000339804.1.89631 WP_000339804.1.89646 WP_000339804.1.89656 WP_000339804.1.89674 WP_000339804.1.89700 WP_000339804.1.89710 WP_000339804.1.89747 WP_000339804.1.89768 WP_000339804.1.89788 WP_000339804.1.89818 WP_000339804.1.89839 WP_000339804.1.89841 WP_000339804.1.89859 WP_000339804.1.89879 WP_000339804.1.89895 WP_000339804.1.89899 WP_000339804.1.89915 WP_000339804.1.89917 WP_000339804.1.89918 WP_000339804.1.89920 WP_000339804.1.89923 WP_000339804.1.89925 WP_000339804.1.90017 WP_000339804.1.90050 WP_000339804.1.90063 WP_000339804.1.90078 WP_000339804.1.9010 WP_000339804.1.90115 WP_000339804.1.90128 WP_000339804.1.90146 WP_000339804.1.90156 WP_000339804.1.90168 WP_000339804.1.90171 WP_000339804.1.90182 WP_000339804.1.902 WP_000339804.1.90205 WP_000339804.1.90249 WP_000339804.1.90256 WP_000339804.1.90266 WP_000339804.1.90270 WP_000339804.1.90332 WP_000339804.1.90357 WP_000339804.1.90358 WP_000339804.1.9036 WP_000339804.1.9037 WP_000339804.1.90405 WP_000339804.1.90435 WP_000339804.1.90436 WP_000339804.1.90441 WP_000339804.1.90449 WP_000339804.1.90467 WP_000339804.1.90511 WP_000339804.1.90525 WP_000339804.1.90536 WP_000339804.1.90547 WP_000339804.1.9059 WP_000339804.1.90591 WP_000339804.1.90602 WP_000339804.1.90626 WP_000339804.1.90690 WP_000339804.1.90706 WP_000339804.1.90758 WP_000339804.1.90775 WP_000339804.1.9081 WP_000339804.1.90813 WP_000339804.1.90822 WP_000339804.1.90828 WP_000339804.1.90834 WP_000339804.1.9084 WP_000339804.1.90844 WP_000339804.1.90856 WP_000339804.1.90864 WP_000339804.1.90873 WP_000339804.1.90890 WP_000339804.1.909 WP_000339804.1.90905 WP_000339804.1.90924 WP_000339804.1.90951 WP_000339804.1.90979 WP_000339804.1.90988 WP_000339804.1.90996 WP_000339804.1.91 WP_000339804.1.91094 WP_000339804.1.91117 WP_000339804.1.91121 WP_000339804.1.91138 WP_000339804.1.91143 WP_000339804.1.91170 WP_000339804.1.9118 WP_000339804.1.9119 WP_000339804.1.91220 WP_000339804.1.91266 WP_000339804.1.91268 WP_000339804.1.91277 WP_000339804.1.91290 WP_000339804.1.91340 WP_000339804.1.91341 WP_000339804.1.91354 WP_000339804.1.91397 WP_000339804.1.91414 WP_000339804.1.91445 WP_000339804.1.91462 WP_000339804.1.91482 WP_000339804.1.91485 WP_000339804.1.915 WP_000339804.1.91511 WP_000339804.1.91515 WP_000339804.1.91516 WP_000339804.1.91526 WP_000339804.1.91551 WP_000339804.1.91565 WP_000339804.1.91566 WP_000339804.1.9157 WP_000339804.1.91594 WP_000339804.1.91596 WP_000339804.1.9160 WP_000339804.1.91630 WP_000339804.1.91644 WP_000339804.1.91666 WP_000339804.1.91672 WP_000339804.1.91685 WP_000339804.1.9169 WP_000339804.1.91701 WP_000339804.1.9171 WP_000339804.1.91756 WP_000339804.1.91777 WP_000339804.1.91779 WP_000339804.1.91782 WP_000339804.1.91787 WP_000339804.1.91793 WP_000339804.1.91814 WP_000339804.1.91843 WP_000339804.1.91850 WP_000339804.1.91863 WP_000339804.1.91879 WP_000339804.1.91887 WP_000339804.1.91893 WP_000339804.1.91951 WP_000339804.1.91959 WP_000339804.1.91994 WP_000339804.1.92014 WP_000339804.1.92019 WP_000339804.1.92029 WP_000339804.1.92031 WP_000339804.1.92048 WP_000339804.1.92053 WP_000339804.1.92058 WP_000339804.1.9209 WP_000339804.1.92096 WP_000339804.1.921 WP_000339804.1.92102 WP_000339804.1.92114 WP_000339804.1.9215 WP_000339804.1.92161 WP_000339804.1.92163 WP_000339804.1.92195 WP_000339804.1.92201 WP_000339804.1.92215 WP_000339804.1.92276 WP_000339804.1.92304 WP_000339804.1.92323 WP_000339804.1.92361 WP_000339804.1.92384 WP_000339804.1.924 WP_000339804.1.92403 WP_000339804.1.92434 WP_000339804.1.92462 WP_000339804.1.92495 WP_000339804.1.92496 WP_000339804.1.92506 WP_000339804.1.92532 WP_000339804.1.92535 WP_000339804.1.9255 WP_000339804.1.92568 WP_000339804.1.92571 WP_000339804.1.92577 WP_000339804.1.92614 WP_000339804.1.92615 WP_000339804.1.9264 WP_000339804.1.92648 WP_000339804.1.92668 WP_000339804.1.92693 WP_000339804.1.92708 WP_000339804.1.92719 WP_000339804.1.92742 WP_000339804.1.92750 WP_000339804.1.92767 WP_000339804.1.92780 WP_000339804.1.92792 WP_000339804.1.92793 WP_000339804.1.92796 WP_000339804.1.92845 WP_000339804.1.92932 WP_000339804.1.92953 WP_000339804.1.92989 WP_000339804.1.92991 WP_000339804.1.93005 WP_000339804.1.93016 WP_000339804.1.93017 WP_000339804.1.93019 WP_000339804.1.93033 WP_000339804.1.93048 WP_000339804.1.93054 WP_000339804.1.93072 WP_000339804.1.93085 WP_000339804.1.93100 WP_000339804.1.93112 WP_000339804.1.93138 WP_000339804.1.93139 WP_000339804.1.93175 WP_000339804.1.93267 WP_000339804.1.9327 WP_000339804.1.93276 WP_000339804.1.93291 WP_000339804.1.93312 WP_000339804.1.93326 WP_000339804.1.93379 WP_000339804.1.93388 WP_000339804.1.934 WP_000339804.1.93461 WP_000339804.1.93463 WP_000339804.1.93464 WP_000339804.1.93468 WP_000339804.1.93531 WP_000339804.1.93533 WP_000339804.1.93569 WP_000339804.1.93621 WP_000339804.1.93626 WP_000339804.1.93629 WP_000339804.1.93637 WP_000339804.1.93639 WP_000339804.1.93652 WP_000339804.1.93665 WP_000339804.1.93673 WP_000339804.1.93679 WP_000339804.1.93694 WP_000339804.1.93733 WP_000339804.1.93742 WP_000339804.1.93743 WP_000339804.1.93755 WP_000339804.1.93765 WP_000339804.1.938 WP_000339804.1.93870 WP_000339804.1.93877 WP_000339804.1.939 WP_000339804.1.93900 WP_000339804.1.93911 WP_000339804.1.93918 WP_000339804.1.93921 WP_000339804.1.93922 WP_000339804.1.93939 WP_000339804.1.93951 WP_000339804.1.94011 WP_000339804.1.94025 WP_000339804.1.94028 WP_000339804.1.94040 WP_000339804.1.94057 WP_000339804.1.94069 WP_000339804.1.94156 WP_000339804.1.94176 WP_000339804.1.9420 WP_000339804.1.94232 WP_000339804.1.94271 WP_000339804.1.94282 WP_000339804.1.94298 WP_000339804.1.94317 WP_000339804.1.94353 WP_000339804.1.94367 WP_000339804.1.94388 WP_000339804.1.94404 WP_000339804.1.94417 WP_000339804.1.94429 WP_000339804.1.94436 WP_000339804.1.94438 WP_000339804.1.94445 WP_000339804.1.94446 WP_000339804.1.94468 WP_000339804.1.94475 WP_000339804.1.94497 WP_000339804.1.94516 WP_000339804.1.94523 WP_000339804.1.94548 WP_000339804.1.9457 WP_000339804.1.94578 WP_000339804.1.94580 WP_000339804.1.94619 WP_000339804.1.94626 WP_000339804.1.94646 WP_000339804.1.94653 WP_000339804.1.94686 WP_000339804.1.94690 WP_000339804.1.94692 WP_000339804.1.94695 WP_000339804.1.94704 WP_000339804.1.94738 WP_000339804.1.9474 WP_000339804.1.94753 WP_000339804.1.94754 WP_000339804.1.94764 WP_000339804.1.94787 WP_000339804.1.948 WP_000339804.1.94801 WP_000339804.1.94806 WP_000339804.1.94808 WP_000339804.1.94822 WP_000339804.1.94836 WP_000339804.1.94869 WP_000339804.1.94877 WP_000339804.1.94880 WP_000339804.1.9489 WP_000339804.1.94892 WP_000339804.1.94898 WP_000339804.1.949 WP_000339804.1.94903 WP_000339804.1.9491 WP_000339804.1.94935 WP_000339804.1.94938 WP_000339804.1.94949 WP_000339804.1.94955 WP_000339804.1.94963 WP_000339804.1.94993 WP_000339804.1.94997 WP_000339804.1.95005 WP_000339804.1.95022 WP_000339804.1.95036 WP_000339804.1.95037 WP_000339804.1.95062 WP_000339804.1.95084 WP_000339804.1.95105 WP_000339804.1.9513 WP_000339804.1.95161 WP_000339804.1.95198 WP_000339804.1.95233 WP_000339804.1.95243 WP_000339804.1.95244 WP_000339804.1.95275 WP_000339804.1.95310 WP_000339804.1.95329 WP_000339804.1.95332 WP_000339804.1.95364 WP_000339804.1.95366 WP_000339804.1.95368 WP_000339804.1.95378 WP_000339804.1.95381 WP_000339804.1.95390 WP_000339804.1.95395 WP_000339804.1.95398 WP_000339804.1.95400 WP_000339804.1.95403 WP_000339804.1.95424 WP_000339804.1.95428 WP_000339804.1.95431 WP_000339804.1.95438 WP_000339804.1.95449 WP_000339804.1.95490 WP_000339804.1.95521 WP_000339804.1.95563 WP_000339804.1.9559 WP_000339804.1.95595 WP_000339804.1.95596 WP_000339804.1.95604 WP_000339804.1.95611 WP_000339804.1.95628 WP_000339804.1.95634 WP_000339804.1.95655 WP_000339804.1.9566 WP_000339804.1.95666 WP_000339804.1.95756 WP_000339804.1.95759 WP_000339804.1.95771 WP_000339804.1.95783 WP_000339804.1.95821 WP_000339804.1.95824 WP_000339804.1.95827 WP_000339804.1.95835 WP_000339804.1.95849 WP_000339804.1.95858 WP_000339804.1.95861 WP_000339804.1.95865 WP_000339804.1.95916 WP_000339804.1.95929 WP_000339804.1.95931 WP_000339804.1.95932 WP_000339804.1.960 WP_000339804.1.96032 WP_000339804.1.96053 WP_000339804.1.96066 WP_000339804.1.96086 WP_000339804.1.96097 WP_000339804.1.96114 WP_000339804.1.96143 WP_000339804.1.96145 WP_000339804.1.96177 WP_000339804.1.96215 WP_000339804.1.96222 WP_000339804.1.96223 WP_000339804.1.96293 WP_000339804.1.96299 WP_000339804.1.96339 WP_000339804.1.96341 WP_000339804.1.96394 WP_000339804.1.9641 WP_000339804.1.96417 WP_000339804.1.96420 WP_000339804.1.96457 WP_000339804.1.96478 WP_000339804.1.96484 WP_000339804.1.9649 WP_000339804.1.96494 WP_000339804.1.96558 WP_000339804.1.96562 WP_000339804.1.9657 WP_000339804.1.96585 WP_000339804.1.96609 WP_000339804.1.9661 WP_000339804.1.96633 WP_000339804.1.96650 WP_000339804.1.96659 WP_000339804.1.96676 WP_000339804.1.9668 WP_000339804.1.96683 WP_000339804.1.96695 WP_000339804.1.96701 WP_000339804.1.9671 WP_000339804.1.96743 WP_000339804.1.96753 WP_000339804.1.96762 WP_000339804.1.96779 WP_000339804.1.96797 WP_000339804.1.96817 WP_000339804.1.9682 WP_000339804.1.96850 WP_000339804.1.9690 WP_000339804.1.96907 WP_000339804.1.9691 WP_000339804.1.96924 WP_000339804.1.96936 WP_000339804.1.96944 WP_000339804.1.96989 WP_000339804.1.97011 WP_000339804.1.97027 WP_000339804.1.97049 WP_000339804.1.97059 WP_000339804.1.9708 WP_000339804.1.97119 WP_000339804.1.97123 WP_000339804.1.97147 WP_000339804.1.97170 WP_000339804.1.97195 WP_000339804.1.97200 WP_000339804.1.97226 WP_000339804.1.9723 WP_000339804.1.97231 WP_000339804.1.97238 WP_000339804.1.97247 WP_000339804.1.97248 WP_000339804.1.97269 WP_000339804.1.97282 WP_000339804.1.97292 WP_000339804.1.97344 WP_000339804.1.97351 WP_000339804.1.97356 WP_000339804.1.97360 WP_000339804.1.97361 WP_000339804.1.97387 WP_000339804.1.97418 WP_000339804.1.97421 WP_000339804.1.97437 WP_000339804.1.97439 WP_000339804.1.97459 WP_000339804.1.97490 WP_000339804.1.97525 WP_000339804.1.97527 WP_000339804.1.97538 WP_000339804.1.97544 WP_000339804.1.97560 WP_000339804.1.97654 WP_000339804.1.97675 WP_000339804.1.97677 WP_000339804.1.97685 WP_000339804.1.97705 WP_000339804.1.97711 WP_000339804.1.97770 WP_000339804.1.97775 WP_000339804.1.97778 WP_000339804.1.97802 WP_000339804.1.97822 WP_000339804.1.97825 WP_000339804.1.97895 WP_000339804.1.97930 WP_000339804.1.97932 WP_000339804.1.97937 WP_000339804.1.97962 WP_000339804.1.98005 WP_000339804.1.98026 WP_000339804.1.9803 WP_000339804.1.98082 WP_000339804.1.98102 WP_000339804.1.98115 WP_000339804.1.98139 WP_000339804.1.9817 WP_000339804.1.98208 WP_000339804.1.98232 WP_000339804.1.98235 WP_000339804.1.98239 WP_000339804.1.98244 WP_000339804.1.98251 WP_000339804.1.98284 WP_000339804.1.98292 WP_000339804.1.98294 WP_000339804.1.98301 WP_000339804.1.98355 WP_000339804.1.98400 WP_000339804.1.98404 WP_000339804.1.98424 WP_000339804.1.9844 WP_000339804.1.98442 WP_000339804.1.98477 WP_000339804.1.98480 WP_000339804.1.98484 WP_000339804.1.98498 WP_000339804.1.98578 WP_000339804.1.9858 WP_000339804.1.98587 WP_000339804.1.98603 WP_000339804.1.98614 WP_000339804.1.98628 WP_000339804.1.98633 WP_000339804.1.9864 WP_000339804.1.98641 WP_000339804.1.98654 WP_000339804.1.98665 WP_000339804.1.98668 WP_000339804.1.98702 WP_000339804.1.98727 WP_000339804.1.98775 WP_000339804.1.98776 WP_000339804.1.98875 WP_000339804.1.98886 WP_000339804.1.98908 WP_000339804.1.98976 WP_000339804.1.98988 WP_000339804.1.99029 WP_000339804.1.99046 WP_000339804.1.99053 WP_000339804.1.99060 WP_000339804.1.9907 WP_000339804.1.99110 WP_000339804.1.99168 WP_000339804.1.99209 WP_000339804.1.99246 WP_000339804.1.99265 WP_000339804.1.99292 WP_000339804.1.9930 WP_000339804.1.99302 WP_000339804.1.99304 WP_000339804.1.99306 WP_000339804.1.99307 WP_000339804.1.99319 WP_000339804.1.99334 WP_000339804.1.99349 WP_000339804.1.9935 WP_000339804.1.99361 WP_000339804.1.99392 WP_000339804.1.99401 WP_000339804.1.99427 WP_000339804.1.99446 WP_000339804.1.99453 WP_000339804.1.99458 WP_000339804.1.99472 WP_000339804.1.99475 WP_000339804.1.99486 WP_000339804.1.99498 WP_000339804.1.9950 WP_000339804.1.99511 WP_000339804.1.99534 WP_000339804.1.99549 WP_000339804.1.99562 WP_000339804.1.99571 WP_000339804.1.99592 WP_000339804.1.99602 WP_000339804.1.99603 WP_000339804.1.99619 WP_000339804.1.99632 WP_000339804.1.99641 WP_000339804.1.99666 WP_000339804.1.99694 WP_000339804.1.99771 WP_000339804.1.99774 WP_000339804.1.99782 WP_000339804.1.99791 WP_000339804.1.99804 WP_000339804.1.99869 WP_000339804.1.99874 WP_000339804.1.99912 YP_006781576.1.12065 gi|386631809|ref|YP_006151529.1| gi|378715242|ref|YP_005280135.1| gi|410484972|ref|YP_006772518.1| 358317 AF79 ER459 UBID_ECOLI yigC gi|386707104|ref|YP_006170951.1| gi|117626121|ref|YP_859444.1| gi|471335336|ref|YP_007558813.1| gi|386711750|ref|YP_006175471.1| gi|443619912|ref|YP_007383768.1| gi|218697562|ref|YP_002405229.1| gi|170022137|ref|YP_001727091.1| gi|387623493|ref|YP_006131121.1| gi|386621690|ref|YP_006141270.1| gi|209921320|ref|YP_002295404.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]