SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|407470085|ref|YP_006783472.1| from Escherichia coli O104:H4 str. 2009EL-2071

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|407470085|ref|YP_006783472.1|
Domain Number 1 Region: 218-327
Classification Level Classification E-value
Superfamily TPR-like 2.35e-19
Family Tetratricopeptide repeat (TPR) 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|407470085|ref|YP_006783472.1|
Sequence length 350
Comment heme lyase, CcmH subunit [Escherichia coli O104:H4 str. 2009EL-2071]
Sequence
MRFLLGVLMLMISGSALATIDVLQFKDEAQEQQFRQLTEELRCPKCQNNSIADSNSMIAT
DLRQKVYELMQEGKSKKEIVDYMVARYGNFVTYDPPLTPLTVLLWVLPVVAIGIGGWVIY
ARSRRRVRVVPEAFPEQSVQEGKRAGYIVYLPGIVVALIVAGVSYYQTGNYQQVKIWQQA
TAQAPALLDRALDPKADPLNEEEMSRLALGMRTQLQKNPGDIEGWIMLGRVGMALGNASI
ATDAYATAYRLDPKNSDAALGYAEALTRSSDPNDNRLGGELLRQLVRSDHSNIRVLSMYA
FNAFEQQRFGEAVAAWEMMLKLLPANDTRRAVIERSIAQAMQHLSPQESK
Download sequence
Identical sequences A0A0E0XX31 A0A0E2TWS8 A0A1X3L1S6 A0A222QMI2 A7ZP16 B7LAL7 C8U6D2 E8Q1Q6 E9T9A2 F4NDV7 I2S0W5 I2WNR8 V6G209 W1F8N1 W8SZ53
gi|410481799|ref|YP_006769345.1| gi|378712358|ref|YP_005277251.1| gi|218554762|ref|YP_002387675.1| gi|386710068|ref|YP_006173789.1| gi|407481252|ref|YP_006778401.1| gi|386710068|ref|YP_006173789.1| gi|218695806|ref|YP_002403473.1| gi|157156945|ref|YP_001463545.1| 331111.EcE24377A_2493 585034.ECIAI1_2276 585055.EC55989_2447 585395.ECO103_2669 gi|544390810|ref|YP_008565382.1| gi|260844796|ref|YP_003222574.1| gi|378712358|ref|YP_005277251.1| gi|407470085|ref|YP_006783472.1| WP_001211587.1.1000 WP_001211587.1.100066 WP_001211587.1.100252 WP_001211587.1.100283 WP_001211587.1.100346 WP_001211587.1.100499 WP_001211587.1.100573 WP_001211587.1.10068 WP_001211587.1.100752 WP_001211587.1.100796 WP_001211587.1.10080 WP_001211587.1.100867 WP_001211587.1.101102 WP_001211587.1.101257 WP_001211587.1.10126 WP_001211587.1.101359 WP_001211587.1.101518 WP_001211587.1.101651 WP_001211587.1.10184 WP_001211587.1.101845 WP_001211587.1.10190 WP_001211587.1.101947 WP_001211587.1.101969 WP_001211587.1.101987 WP_001211587.1.10379 WP_001211587.1.10400 WP_001211587.1.10651 WP_001211587.1.1071 WP_001211587.1.1073 WP_001211587.1.1074 WP_001211587.1.10940 WP_001211587.1.10994 WP_001211587.1.11006 WP_001211587.1.11091 WP_001211587.1.11133 WP_001211587.1.112 WP_001211587.1.1122 WP_001211587.1.11524 WP_001211587.1.11645 WP_001211587.1.11748 WP_001211587.1.1186 WP_001211587.1.12051 WP_001211587.1.12279 WP_001211587.1.12342 WP_001211587.1.12344 WP_001211587.1.12566 WP_001211587.1.12623 WP_001211587.1.12693 WP_001211587.1.1275 WP_001211587.1.12781 WP_001211587.1.12979 WP_001211587.1.1315 WP_001211587.1.13162 WP_001211587.1.13301 WP_001211587.1.13495 WP_001211587.1.13601 WP_001211587.1.13944 WP_001211587.1.14199 WP_001211587.1.14304 WP_001211587.1.1439 WP_001211587.1.14417 WP_001211587.1.14432 WP_001211587.1.14582 WP_001211587.1.14672 WP_001211587.1.14678 WP_001211587.1.1470 WP_001211587.1.14977 WP_001211587.1.14993 WP_001211587.1.15041 WP_001211587.1.15087 WP_001211587.1.15193 WP_001211587.1.15270 WP_001211587.1.15282 WP_001211587.1.15300 WP_001211587.1.1543 WP_001211587.1.15464 WP_001211587.1.15521 WP_001211587.1.15538 WP_001211587.1.15583 WP_001211587.1.1561 WP_001211587.1.15707 WP_001211587.1.15767 WP_001211587.1.15809 WP_001211587.1.15945 WP_001211587.1.15983 WP_001211587.1.16183 WP_001211587.1.16194 WP_001211587.1.1621 WP_001211587.1.16388 WP_001211587.1.16539 WP_001211587.1.16592 WP_001211587.1.16648 WP_001211587.1.1673 WP_001211587.1.16745 WP_001211587.1.17111 WP_001211587.1.17172 WP_001211587.1.17182 WP_001211587.1.17241 WP_001211587.1.17267 WP_001211587.1.17373 WP_001211587.1.17392 WP_001211587.1.17403 WP_001211587.1.17417 WP_001211587.1.1754 WP_001211587.1.17550 WP_001211587.1.1766 WP_001211587.1.1769 WP_001211587.1.17766 WP_001211587.1.17961 WP_001211587.1.17984 WP_001211587.1.18164 WP_001211587.1.18175 WP_001211587.1.18338 WP_001211587.1.1844 WP_001211587.1.18519 WP_001211587.1.18666 WP_001211587.1.18714 WP_001211587.1.188 WP_001211587.1.18861 WP_001211587.1.18923 WP_001211587.1.18983 WP_001211587.1.19147 WP_001211587.1.1925 WP_001211587.1.19297 WP_001211587.1.19312 WP_001211587.1.19389 WP_001211587.1.19397 WP_001211587.1.19544 WP_001211587.1.19581 WP_001211587.1.19655 WP_001211587.1.20129 WP_001211587.1.20157 WP_001211587.1.20159 WP_001211587.1.20166 WP_001211587.1.20215 WP_001211587.1.20483 WP_001211587.1.20519 WP_001211587.1.20630 WP_001211587.1.20662 WP_001211587.1.20730 WP_001211587.1.20848 WP_001211587.1.21104 WP_001211587.1.21248 WP_001211587.1.21320 WP_001211587.1.21441 WP_001211587.1.21519 WP_001211587.1.21596 WP_001211587.1.21812 WP_001211587.1.21948 WP_001211587.1.22204 WP_001211587.1.22350 WP_001211587.1.22777 WP_001211587.1.22908 WP_001211587.1.23135 WP_001211587.1.23376 WP_001211587.1.23383 WP_001211587.1.23393 WP_001211587.1.23640 WP_001211587.1.23970 WP_001211587.1.24136 WP_001211587.1.24233 WP_001211587.1.24278 WP_001211587.1.24383 WP_001211587.1.24473 WP_001211587.1.24483 WP_001211587.1.24485 WP_001211587.1.24575 WP_001211587.1.24642 WP_001211587.1.24650 WP_001211587.1.24695 WP_001211587.1.2479 WP_001211587.1.24849 WP_001211587.1.24929 WP_001211587.1.24939 WP_001211587.1.24984 WP_001211587.1.25039 WP_001211587.1.25050 WP_001211587.1.25087 WP_001211587.1.25414 WP_001211587.1.2543 WP_001211587.1.25548 WP_001211587.1.25631 WP_001211587.1.25945 WP_001211587.1.26055 WP_001211587.1.26061 WP_001211587.1.26100 WP_001211587.1.26130 WP_001211587.1.26161 WP_001211587.1.26191 WP_001211587.1.26270 WP_001211587.1.26325 WP_001211587.1.2637 WP_001211587.1.26391 WP_001211587.1.2642 WP_001211587.1.26517 WP_001211587.1.26613 WP_001211587.1.26658 WP_001211587.1.26683 WP_001211587.1.26736 WP_001211587.1.26912 WP_001211587.1.27060 WP_001211587.1.27234 WP_001211587.1.27287 WP_001211587.1.27330 WP_001211587.1.27723 WP_001211587.1.27749 WP_001211587.1.27758 WP_001211587.1.27856 WP_001211587.1.27876 WP_001211587.1.28109 WP_001211587.1.28110 WP_001211587.1.2823 WP_001211587.1.28250 WP_001211587.1.28401 WP_001211587.1.28523 WP_001211587.1.28540 WP_001211587.1.28683 WP_001211587.1.29118 WP_001211587.1.29125 WP_001211587.1.29503 WP_001211587.1.29590 WP_001211587.1.29840 WP_001211587.1.29874 WP_001211587.1.30098 WP_001211587.1.30105 WP_001211587.1.30123 WP_001211587.1.30399 WP_001211587.1.30742 WP_001211587.1.30853 WP_001211587.1.30906 WP_001211587.1.31347 WP_001211587.1.31419 WP_001211587.1.31521 WP_001211587.1.31803 WP_001211587.1.31860 WP_001211587.1.32091 WP_001211587.1.3215 WP_001211587.1.32184 WP_001211587.1.32234 WP_001211587.1.32406 WP_001211587.1.32561 WP_001211587.1.32655 WP_001211587.1.32680 WP_001211587.1.32709 WP_001211587.1.32724 WP_001211587.1.32910 WP_001211587.1.32946 WP_001211587.1.32959 WP_001211587.1.32972 WP_001211587.1.32992 WP_001211587.1.33004 WP_001211587.1.33018 WP_001211587.1.33119 WP_001211587.1.33341 WP_001211587.1.33385 WP_001211587.1.33475 WP_001211587.1.33638 WP_001211587.1.33667 WP_001211587.1.33823 WP_001211587.1.34094 WP_001211587.1.34122 WP_001211587.1.34206 WP_001211587.1.34273 WP_001211587.1.34341 WP_001211587.1.34397 WP_001211587.1.3444 WP_001211587.1.34682 WP_001211587.1.34781 WP_001211587.1.34855 WP_001211587.1.35006 WP_001211587.1.35464 WP_001211587.1.35465 WP_001211587.1.35552 WP_001211587.1.35604 WP_001211587.1.35922 WP_001211587.1.35934 WP_001211587.1.35942 WP_001211587.1.36042 WP_001211587.1.36070 WP_001211587.1.36085 WP_001211587.1.36412 WP_001211587.1.36500 WP_001211587.1.36628 WP_001211587.1.36707 WP_001211587.1.36812 WP_001211587.1.36975 WP_001211587.1.37099 WP_001211587.1.37206 WP_001211587.1.37554 WP_001211587.1.37762 WP_001211587.1.37773 WP_001211587.1.37847 WP_001211587.1.37887 WP_001211587.1.37926 WP_001211587.1.38120 WP_001211587.1.3822 WP_001211587.1.38257 WP_001211587.1.38357 WP_001211587.1.38629 WP_001211587.1.3873 WP_001211587.1.38911 WP_001211587.1.39037 WP_001211587.1.39042 WP_001211587.1.39171 WP_001211587.1.39305 WP_001211587.1.39481 WP_001211587.1.39607 WP_001211587.1.39610 WP_001211587.1.39690 WP_001211587.1.39758 WP_001211587.1.39780 WP_001211587.1.40315 WP_001211587.1.40335 WP_001211587.1.40403 WP_001211587.1.4049 WP_001211587.1.40509 WP_001211587.1.40563 WP_001211587.1.40666 WP_001211587.1.40781 WP_001211587.1.40813 WP_001211587.1.40865 WP_001211587.1.41147 WP_001211587.1.41263 WP_001211587.1.41287 WP_001211587.1.41315 WP_001211587.1.4142 WP_001211587.1.41479 WP_001211587.1.41545 WP_001211587.1.41566 WP_001211587.1.41654 WP_001211587.1.41712 WP_001211587.1.4172 WP_001211587.1.41740 WP_001211587.1.41752 WP_001211587.1.41964 WP_001211587.1.42060 WP_001211587.1.4214 WP_001211587.1.4224 WP_001211587.1.42456 WP_001211587.1.42480 WP_001211587.1.42749 WP_001211587.1.42756 WP_001211587.1.42813 WP_001211587.1.42937 WP_001211587.1.42962 WP_001211587.1.43132 WP_001211587.1.43137 WP_001211587.1.43177 WP_001211587.1.43239 WP_001211587.1.43363 WP_001211587.1.43474 WP_001211587.1.43598 WP_001211587.1.43642 WP_001211587.1.43750 WP_001211587.1.43769 WP_001211587.1.44029 WP_001211587.1.44040 WP_001211587.1.44075 WP_001211587.1.44273 WP_001211587.1.44445 WP_001211587.1.44461 WP_001211587.1.4449 WP_001211587.1.44524 WP_001211587.1.44661 WP_001211587.1.44961 WP_001211587.1.45053 WP_001211587.1.45359 WP_001211587.1.45444 WP_001211587.1.45600 WP_001211587.1.4570 WP_001211587.1.45840 WP_001211587.1.45846 WP_001211587.1.45865 WP_001211587.1.45930 WP_001211587.1.45968 WP_001211587.1.46027 WP_001211587.1.46048 WP_001211587.1.46049 WP_001211587.1.46070 WP_001211587.1.46197 WP_001211587.1.46239 WP_001211587.1.4646 WP_001211587.1.46477 WP_001211587.1.46602 WP_001211587.1.46616 WP_001211587.1.46743 WP_001211587.1.46821 WP_001211587.1.46898 WP_001211587.1.4691 WP_001211587.1.47029 WP_001211587.1.47050 WP_001211587.1.47063 WP_001211587.1.47069 WP_001211587.1.47246 WP_001211587.1.47280 WP_001211587.1.47332 WP_001211587.1.47398 WP_001211587.1.4740 WP_001211587.1.47555 WP_001211587.1.4785 WP_001211587.1.47976 WP_001211587.1.48188 WP_001211587.1.48291 WP_001211587.1.48355 WP_001211587.1.48385 WP_001211587.1.4857 WP_001211587.1.48615 WP_001211587.1.48771 WP_001211587.1.48901 WP_001211587.1.48926 WP_001211587.1.48928 WP_001211587.1.49124 WP_001211587.1.49147 WP_001211587.1.49190 WP_001211587.1.49312 WP_001211587.1.49459 WP_001211587.1.49481 WP_001211587.1.4949 WP_001211587.1.49546 WP_001211587.1.49774 WP_001211587.1.49954 WP_001211587.1.49987 WP_001211587.1.50036 WP_001211587.1.50207 WP_001211587.1.50361 WP_001211587.1.50366 WP_001211587.1.50418 WP_001211587.1.5064 WP_001211587.1.50715 WP_001211587.1.50939 WP_001211587.1.50996 WP_001211587.1.51058 WP_001211587.1.51109 WP_001211587.1.51323 WP_001211587.1.51405 WP_001211587.1.51427 WP_001211587.1.51462 WP_001211587.1.51490 WP_001211587.1.51525 WP_001211587.1.51707 WP_001211587.1.51718 WP_001211587.1.51837 WP_001211587.1.51839 WP_001211587.1.51985 WP_001211587.1.51999 WP_001211587.1.52171 WP_001211587.1.5239 WP_001211587.1.52612 WP_001211587.1.52662 WP_001211587.1.52691 WP_001211587.1.52710 WP_001211587.1.52762 WP_001211587.1.52801 WP_001211587.1.52846 WP_001211587.1.52852 WP_001211587.1.52908 WP_001211587.1.52913 WP_001211587.1.52995 WP_001211587.1.53027 WP_001211587.1.53065 WP_001211587.1.532 WP_001211587.1.5322 WP_001211587.1.53242 WP_001211587.1.53262 WP_001211587.1.53356 WP_001211587.1.5342 WP_001211587.1.5362 WP_001211587.1.53642 WP_001211587.1.53706 WP_001211587.1.53841 WP_001211587.1.53978 WP_001211587.1.54023 WP_001211587.1.54185 WP_001211587.1.54202 WP_001211587.1.54317 WP_001211587.1.54546 WP_001211587.1.54591 WP_001211587.1.54638 WP_001211587.1.54688 WP_001211587.1.54725 WP_001211587.1.54729 WP_001211587.1.54798 WP_001211587.1.54817 WP_001211587.1.54829 WP_001211587.1.55115 WP_001211587.1.55144 WP_001211587.1.55291 WP_001211587.1.55338 WP_001211587.1.55342 WP_001211587.1.55417 WP_001211587.1.55597 WP_001211587.1.5561 WP_001211587.1.5570 WP_001211587.1.55709 WP_001211587.1.55787 WP_001211587.1.56149 WP_001211587.1.5616 WP_001211587.1.56216 WP_001211587.1.56231 WP_001211587.1.56302 WP_001211587.1.56371 WP_001211587.1.56390 WP_001211587.1.56399 WP_001211587.1.56439 WP_001211587.1.56586 WP_001211587.1.56689 WP_001211587.1.56704 WP_001211587.1.56721 WP_001211587.1.56742 WP_001211587.1.5685 WP_001211587.1.57100 WP_001211587.1.57185 WP_001211587.1.57216 WP_001211587.1.57222 WP_001211587.1.5748 WP_001211587.1.57487 WP_001211587.1.5755 WP_001211587.1.57629 WP_001211587.1.57638 WP_001211587.1.57659 WP_001211587.1.57920 WP_001211587.1.58143 WP_001211587.1.58146 WP_001211587.1.58206 WP_001211587.1.58267 WP_001211587.1.58289 WP_001211587.1.58371 WP_001211587.1.58408 WP_001211587.1.58445 WP_001211587.1.58507 WP_001211587.1.58514 WP_001211587.1.58572 WP_001211587.1.58582 WP_001211587.1.58870 WP_001211587.1.58901 WP_001211587.1.59083 WP_001211587.1.59199 WP_001211587.1.59293 WP_001211587.1.59409 WP_001211587.1.59434 WP_001211587.1.59621 WP_001211587.1.59638 WP_001211587.1.59791 WP_001211587.1.59836 WP_001211587.1.6022 WP_001211587.1.60325 WP_001211587.1.60387 WP_001211587.1.60491 WP_001211587.1.6064 WP_001211587.1.60698 WP_001211587.1.60732 WP_001211587.1.61058 WP_001211587.1.61225 WP_001211587.1.61292 WP_001211587.1.61758 WP_001211587.1.61806 WP_001211587.1.62041 WP_001211587.1.62264 WP_001211587.1.62273 WP_001211587.1.62358 WP_001211587.1.62447 WP_001211587.1.62460 WP_001211587.1.62681 WP_001211587.1.62714 WP_001211587.1.62762 WP_001211587.1.62769 WP_001211587.1.62850 WP_001211587.1.62914 WP_001211587.1.62931 WP_001211587.1.62959 WP_001211587.1.62973 WP_001211587.1.63466 WP_001211587.1.63470 WP_001211587.1.63556 WP_001211587.1.63576 WP_001211587.1.63666 WP_001211587.1.63821 WP_001211587.1.64150 WP_001211587.1.64175 WP_001211587.1.64193 WP_001211587.1.64355 WP_001211587.1.64380 WP_001211587.1.6441 WP_001211587.1.64519 WP_001211587.1.64657 WP_001211587.1.64926 WP_001211587.1.65023 WP_001211587.1.65151 WP_001211587.1.65179 WP_001211587.1.65305 WP_001211587.1.654 WP_001211587.1.65493 WP_001211587.1.65708 WP_001211587.1.6599 WP_001211587.1.66007 WP_001211587.1.66094 WP_001211587.1.66181 WP_001211587.1.66412 WP_001211587.1.6645 WP_001211587.1.66644 WP_001211587.1.6676 WP_001211587.1.66783 WP_001211587.1.66926 WP_001211587.1.66948 WP_001211587.1.67116 WP_001211587.1.67120 WP_001211587.1.67194 WP_001211587.1.67209 WP_001211587.1.6735 WP_001211587.1.67383 WP_001211587.1.67663 WP_001211587.1.67841 WP_001211587.1.68011 WP_001211587.1.68039 WP_001211587.1.68241 WP_001211587.1.68278 WP_001211587.1.68347 WP_001211587.1.68442 WP_001211587.1.68673 WP_001211587.1.68678 WP_001211587.1.68695 WP_001211587.1.68751 WP_001211587.1.68915 WP_001211587.1.68956 WP_001211587.1.69126 WP_001211587.1.69589 WP_001211587.1.69649 WP_001211587.1.69689 WP_001211587.1.69887 WP_001211587.1.70414 WP_001211587.1.70477 WP_001211587.1.7052 WP_001211587.1.70592 WP_001211587.1.70745 WP_001211587.1.70803 WP_001211587.1.70967 WP_001211587.1.71062 WP_001211587.1.71162 WP_001211587.1.71221 WP_001211587.1.71354 WP_001211587.1.71533 WP_001211587.1.71680 WP_001211587.1.7192 WP_001211587.1.72021 WP_001211587.1.72053 WP_001211587.1.72090 WP_001211587.1.72125 WP_001211587.1.72141 WP_001211587.1.72240 WP_001211587.1.72521 WP_001211587.1.72535 WP_001211587.1.72582 WP_001211587.1.72608 WP_001211587.1.72695 WP_001211587.1.72725 WP_001211587.1.72729 WP_001211587.1.72764 WP_001211587.1.72837 WP_001211587.1.73010 WP_001211587.1.73072 WP_001211587.1.73197 WP_001211587.1.73239 WP_001211587.1.73249 WP_001211587.1.73251 WP_001211587.1.73349 WP_001211587.1.73428 WP_001211587.1.7349 WP_001211587.1.73700 WP_001211587.1.73882 WP_001211587.1.73897 WP_001211587.1.73908 WP_001211587.1.73995 WP_001211587.1.73996 WP_001211587.1.74051 WP_001211587.1.7413 WP_001211587.1.74444 WP_001211587.1.74624 WP_001211587.1.74670 WP_001211587.1.74687 WP_001211587.1.74705 WP_001211587.1.74735 WP_001211587.1.7478 WP_001211587.1.74895 WP_001211587.1.75029 WP_001211587.1.75050 WP_001211587.1.75112 WP_001211587.1.75465 WP_001211587.1.75629 WP_001211587.1.75696 WP_001211587.1.75973 WP_001211587.1.75999 WP_001211587.1.76005 WP_001211587.1.76009 WP_001211587.1.7603 WP_001211587.1.76036 WP_001211587.1.76087 WP_001211587.1.76103 WP_001211587.1.76129 WP_001211587.1.76325 WP_001211587.1.76384 WP_001211587.1.76390 WP_001211587.1.76619 WP_001211587.1.76656 WP_001211587.1.7699 WP_001211587.1.77070 WP_001211587.1.77162 WP_001211587.1.77255 WP_001211587.1.77341 WP_001211587.1.77437 WP_001211587.1.77462 WP_001211587.1.77477 WP_001211587.1.77495 WP_001211587.1.77551 WP_001211587.1.77581 WP_001211587.1.77626 WP_001211587.1.77767 WP_001211587.1.77833 WP_001211587.1.77929 WP_001211587.1.78099 WP_001211587.1.78445 WP_001211587.1.78515 WP_001211587.1.78586 WP_001211587.1.78683 WP_001211587.1.78687 WP_001211587.1.78888 WP_001211587.1.78891 WP_001211587.1.78919 WP_001211587.1.78966 WP_001211587.1.7901 WP_001211587.1.79067 WP_001211587.1.79346 WP_001211587.1.7937 WP_001211587.1.79391 WP_001211587.1.79800 WP_001211587.1.79905 WP_001211587.1.79932 WP_001211587.1.80043 WP_001211587.1.8007 WP_001211587.1.80106 WP_001211587.1.80176 WP_001211587.1.8076 WP_001211587.1.80894 WP_001211587.1.80983 WP_001211587.1.80985 WP_001211587.1.81026 WP_001211587.1.81036 WP_001211587.1.811 WP_001211587.1.81283 WP_001211587.1.81316 WP_001211587.1.81438 WP_001211587.1.81469 WP_001211587.1.81484 WP_001211587.1.81580 WP_001211587.1.81596 WP_001211587.1.81625 WP_001211587.1.81914 WP_001211587.1.81972 WP_001211587.1.82137 WP_001211587.1.82246 WP_001211587.1.82326 WP_001211587.1.82378 WP_001211587.1.83035 WP_001211587.1.83347 WP_001211587.1.83564 WP_001211587.1.83684 WP_001211587.1.83807 WP_001211587.1.83947 WP_001211587.1.84436 WP_001211587.1.84473 WP_001211587.1.8470 WP_001211587.1.84841 WP_001211587.1.84893 WP_001211587.1.85011 WP_001211587.1.85085 WP_001211587.1.85098 WP_001211587.1.85105 WP_001211587.1.85129 WP_001211587.1.85335 WP_001211587.1.85342 WP_001211587.1.85525 WP_001211587.1.8607 WP_001211587.1.86115 WP_001211587.1.86181 WP_001211587.1.86210 WP_001211587.1.86263 WP_001211587.1.86276 WP_001211587.1.86364 WP_001211587.1.86376 WP_001211587.1.86393 WP_001211587.1.86454 WP_001211587.1.86492 WP_001211587.1.8652 WP_001211587.1.86583 WP_001211587.1.86598 WP_001211587.1.86667 WP_001211587.1.86674 WP_001211587.1.8711 WP_001211587.1.87358 WP_001211587.1.87400 WP_001211587.1.87410 WP_001211587.1.87465 WP_001211587.1.87557 WP_001211587.1.87607 WP_001211587.1.87694 WP_001211587.1.87973 WP_001211587.1.88020 WP_001211587.1.88155 WP_001211587.1.88252 WP_001211587.1.88379 WP_001211587.1.88384 WP_001211587.1.88427 WP_001211587.1.88539 WP_001211587.1.88603 WP_001211587.1.88646 WP_001211587.1.88732 WP_001211587.1.88759 WP_001211587.1.89050 WP_001211587.1.8906 WP_001211587.1.89183 WP_001211587.1.89200 WP_001211587.1.89255 WP_001211587.1.8928 WP_001211587.1.8938 WP_001211587.1.89432 WP_001211587.1.8945 WP_001211587.1.89474 WP_001211587.1.89646 WP_001211587.1.89768 WP_001211587.1.89859 WP_001211587.1.89895 WP_001211587.1.89915 WP_001211587.1.89920 WP_001211587.1.9009 WP_001211587.1.9010 WP_001211587.1.90156 WP_001211587.1.90332 WP_001211587.1.90405 WP_001211587.1.90435 WP_001211587.1.90441 WP_001211587.1.90547 WP_001211587.1.9059 WP_001211587.1.9061 WP_001211587.1.90626 WP_001211587.1.90706 WP_001211587.1.90822 WP_001211587.1.90834 WP_001211587.1.90864 WP_001211587.1.90873 WP_001211587.1.90979 WP_001211587.1.91094 WP_001211587.1.91290 WP_001211587.1.91414 WP_001211587.1.91565 WP_001211587.1.9160 WP_001211587.1.91644 WP_001211587.1.91672 WP_001211587.1.91685 WP_001211587.1.9171 WP_001211587.1.91782 WP_001211587.1.91787 WP_001211587.1.91863 WP_001211587.1.91951 WP_001211587.1.91959 WP_001211587.1.92048 WP_001211587.1.92163 WP_001211587.1.92215 WP_001211587.1.92311 WP_001211587.1.92719 WP_001211587.1.93005 WP_001211587.1.93072 WP_001211587.1.93531 WP_001211587.1.93626 WP_001211587.1.93665 WP_001211587.1.93743 WP_001211587.1.93800 WP_001211587.1.93877 WP_001211587.1.93918 WP_001211587.1.93951 WP_001211587.1.94008 WP_001211587.1.94232 WP_001211587.1.94317 WP_001211587.1.94475 WP_001211587.1.94580 WP_001211587.1.94695 WP_001211587.1.94787 WP_001211587.1.94806 WP_001211587.1.94808 WP_001211587.1.94903 WP_001211587.1.95022 WP_001211587.1.95161 WP_001211587.1.95243 WP_001211587.1.95381 WP_001211587.1.95400 WP_001211587.1.95424 WP_001211587.1.95521 WP_001211587.1.95771 WP_001211587.1.95800 WP_001211587.1.95824 WP_001211587.1.95916 WP_001211587.1.96053 WP_001211587.1.96086 WP_001211587.1.96177 WP_001211587.1.96222 WP_001211587.1.96341 WP_001211587.1.965 WP_001211587.1.96562 WP_001211587.1.9661 WP_001211587.1.96659 WP_001211587.1.96817 WP_001211587.1.9691 WP_001211587.1.96944 WP_001211587.1.97049 WP_001211587.1.97059 WP_001211587.1.97200 WP_001211587.1.97421 WP_001211587.1.97459 WP_001211587.1.97705 WP_001211587.1.97822 WP_001211587.1.97932 WP_001211587.1.97937 WP_001211587.1.97962 WP_001211587.1.9803 WP_001211587.1.98115 WP_001211587.1.98139 WP_001211587.1.9817 WP_001211587.1.98244 WP_001211587.1.98400 WP_001211587.1.98451 WP_001211587.1.98654 WP_001211587.1.98665 WP_001211587.1.98702 WP_001211587.1.98875 WP_001211587.1.98988 WP_001211587.1.99029 WP_001211587.1.99046 WP_001211587.1.99168 WP_001211587.1.99246 WP_001211587.1.99295 WP_001211587.1.99302 WP_001211587.1.99304 WP_001211587.1.99334 WP_001211587.1.99475 WP_001211587.1.99511 WP_001211587.1.99592 WP_001211587.1.99632 WP_001211587.1.99804 YP_006778401.1.12065

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]