SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|253771802|ref|YP_003034633.1| from Escherichia coli 'BL21-Gold(DE3)pLysS AG'

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|253771802|ref|YP_003034633.1|
Domain Number 1 Region: 16-338
Classification Level Classification E-value
Superfamily SIS domain 1.14e-55
Family double-SIS domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|253771802|ref|YP_003034633.1|
Sequence length 340
Comment fructoselysine-6-P-deglycase [Escherichia coli 'BL21-Gold(DE3)pLysS AG']
Sequence
MLDIDKSTVDFLVTENMVQEVEKVLSHDVPLVHAIVEEMVKRDIDRIYFVACGSPLNAAQ
TAKHLADRFSDLQVYAISGWEFCDNTPYRLDDRCAVIGVSDYGKTEEVIKALELGRACGA
LTAAFTKRADSPITSAAEFSIDYQADCIWEIHLLLCYSVVLEMITRLAPNAEIGKIKNDL
KQLPNALGHLVRTWEEKGRQLGELASQWPMIYTVAAGPLRPLGYKEGIVTLMEFTWTHGC
VIESGEFRHGPLEIVEPGVPFLFLLGNDESRHTTERAINFVKQRTDNVIVIDYAEISQGL
HPWLAPFLMFVPMEWLCYYLSIYKDHNPDERRYYGGLVEY
Download sequence
Identical sequences A0A026V8K6 A0A069XLR5 A0A070SQ47 A0A070V718 A0A073FNQ0 A0A074I9I5 A0A080FK56 A0A0A0FK86 A0A0E0U4E0 A0A0E0XWN8 A0A0E1M2F2 A0A0E2TME5 A0A0M7N2N3 A0A127GTW4 A0A140N4E8 A0A142H7M8 A0A1S6THK7 A0A1W2MIM0 A0A222QR36 A0A236BT97 A0A236PQB1 B7L4P9 E0J003 E3PLH9 G0F5Z3 H4UQ80 I0VVX6 I2RSI5 I2X5A3 I4T7M1 I6B845 L2VFW9 M9GVW8 P0AC00 P0AC01 S1I667 S1IMZ9 V2RTJ0 V6FYD1 W1V336 W8STG0
gi|344915335|ref|NP_709145.4| gi|386706613|ref|YP_006170460.1| gi|387623024|ref|YP_006130652.1| gi|218697052|ref|YP_002404719.1| gi|254163299|ref|YP_003046407.1| gi|170082889|ref|YP_001732209.1| gi|253771802|ref|YP_003034633.1| APC28305 gi|386711251|ref|YP_006174972.1| gi|388479866|ref|YP_492060.1| gi|544391825|ref|YP_008566512.1| gi|251786624|ref|YP_003000928.1| 316385.ECDH10B_3547 316407.frlB 413997.ECB_03222 469008.ECBD_0377 481805.EcolC_0341 511145.b3371 585034.ECIAI1_3510 585055.EC55989_3777 595496.BWG_3063 gi|386616153|ref|YP_006135819.1| gi|410480584|ref|YP_006768130.1| gi|443619435|ref|YP_007383291.1| gi|407471321|ref|YP_006782236.1| gi|378711202|ref|YP_005276095.1| gi|386711251|ref|YP_006174972.1| gi|218555917|ref|YP_002388830.1| gi|170018392|ref|YP_001723346.1| gi|238902463|ref|YP_002928259.1| gi|387614047|ref|YP_006117163.1| gi|162135909|ref|NP_417830.4| gi|378711202|ref|YP_005276095.1| gi|251786624|ref|YP_003000928.1| gi|387623024|ref|YP_006130652.1| gi|407480023|ref|YP_006777172.1| gi|471334902|ref|YP_007558379.1| NP_417830.4.90541 NP_709145.4.23235 WP_001295163.1.1000 WP_001295163.1.100044 WP_001295163.1.100066 WP_001295163.1.100085 WP_001295163.1.100111 WP_001295163.1.100159 WP_001295163.1.100251 WP_001295163.1.10034 WP_001295163.1.100346 WP_001295163.1.100441 WP_001295163.1.100444 WP_001295163.1.100487 WP_001295163.1.100499 WP_001295163.1.10051 WP_001295163.1.100614 WP_001295163.1.10067 WP_001295163.1.10068 WP_001295163.1.100752 WP_001295163.1.100753 WP_001295163.1.10080 WP_001295163.1.100824 WP_001295163.1.10086 WP_001295163.1.100867 WP_001295163.1.100868 WP_001295163.1.100928 WP_001295163.1.100933 WP_001295163.1.10094 WP_001295163.1.101033 WP_001295163.1.101158 WP_001295163.1.101186 WP_001295163.1.101282 WP_001295163.1.101359 WP_001295163.1.101423 WP_001295163.1.101518 WP_001295163.1.101522 WP_001295163.1.101545 WP_001295163.1.101654 WP_001295163.1.101667 WP_001295163.1.10173 WP_001295163.1.101737 WP_001295163.1.101747 WP_001295163.1.101845 WP_001295163.1.10187 WP_001295163.1.10188 WP_001295163.1.10190 WP_001295163.1.101900 WP_001295163.1.101908 WP_001295163.1.101947 WP_001295163.1.101964 WP_001295163.1.101969 WP_001295163.1.101987 WP_001295163.1.10226 WP_001295163.1.10233 WP_001295163.1.10235 WP_001295163.1.10252 WP_001295163.1.10304 WP_001295163.1.10361 WP_001295163.1.1040 WP_001295163.1.10400 WP_001295163.1.10417 WP_001295163.1.10491 WP_001295163.1.10496 WP_001295163.1.1058 WP_001295163.1.10651 WP_001295163.1.10729 WP_001295163.1.10833 WP_001295163.1.10940 WP_001295163.1.10988 WP_001295163.1.10994 WP_001295163.1.11047 WP_001295163.1.11091 WP_001295163.1.11118 WP_001295163.1.1113 WP_001295163.1.11133 WP_001295163.1.11241 WP_001295163.1.11408 WP_001295163.1.11418 WP_001295163.1.11436 WP_001295163.1.11524 WP_001295163.1.11578 WP_001295163.1.11844 WP_001295163.1.11912 WP_001295163.1.1196 WP_001295163.1.11982 WP_001295163.1.12060 WP_001295163.1.1212 WP_001295163.1.12342 WP_001295163.1.12344 WP_001295163.1.12415 WP_001295163.1.1242 WP_001295163.1.12458 WP_001295163.1.12468 WP_001295163.1.12478 WP_001295163.1.12542 WP_001295163.1.12558 WP_001295163.1.12566 WP_001295163.1.12582 WP_001295163.1.12594 WP_001295163.1.12623 WP_001295163.1.12675 WP_001295163.1.12680 WP_001295163.1.12693 WP_001295163.1.127 WP_001295163.1.1275 WP_001295163.1.12756 WP_001295163.1.12775 WP_001295163.1.12914 WP_001295163.1.12965 WP_001295163.1.12987 WP_001295163.1.13002 WP_001295163.1.13015 WP_001295163.1.13031 WP_001295163.1.13074 WP_001295163.1.1312 WP_001295163.1.13136 WP_001295163.1.1315 WP_001295163.1.13157 WP_001295163.1.13176 WP_001295163.1.13239 WP_001295163.1.13252 WP_001295163.1.13258 WP_001295163.1.13278 WP_001295163.1.13281 WP_001295163.1.13290 WP_001295163.1.13301 WP_001295163.1.13333 WP_001295163.1.1335 WP_001295163.1.1345 WP_001295163.1.13451 WP_001295163.1.13495 WP_001295163.1.13525 WP_001295163.1.13585 WP_001295163.1.13608 WP_001295163.1.13618 WP_001295163.1.13624 WP_001295163.1.13644 WP_001295163.1.13664 WP_001295163.1.13672 WP_001295163.1.13877 WP_001295163.1.13949 WP_001295163.1.13974 WP_001295163.1.14030 WP_001295163.1.1419 WP_001295163.1.14199 WP_001295163.1.14277 WP_001295163.1.14292 WP_001295163.1.14304 WP_001295163.1.14346 WP_001295163.1.1438 WP_001295163.1.1439 WP_001295163.1.14398 WP_001295163.1.14468 WP_001295163.1.14501 WP_001295163.1.14536 WP_001295163.1.14582 WP_001295163.1.14600 WP_001295163.1.1461 WP_001295163.1.14661 WP_001295163.1.1470 WP_001295163.1.14833 WP_001295163.1.14871 WP_001295163.1.14879 WP_001295163.1.14956 WP_001295163.1.14992 WP_001295163.1.15041 WP_001295163.1.15117 WP_001295163.1.1512 WP_001295163.1.15121 WP_001295163.1.15177 WP_001295163.1.15270 WP_001295163.1.15282 WP_001295163.1.15377 WP_001295163.1.15464 WP_001295163.1.15496 WP_001295163.1.15521 WP_001295163.1.15538 WP_001295163.1.15583 WP_001295163.1.15600 WP_001295163.1.15620 WP_001295163.1.15740 WP_001295163.1.15747 WP_001295163.1.15767 WP_001295163.1.1588 WP_001295163.1.15945 WP_001295163.1.16086 WP_001295163.1.1609 WP_001295163.1.16111 WP_001295163.1.16154 WP_001295163.1.16179 WP_001295163.1.16183 WP_001295163.1.16194 WP_001295163.1.16294 WP_001295163.1.1634 WP_001295163.1.16388 WP_001295163.1.16435 WP_001295163.1.16500 WP_001295163.1.16532 WP_001295163.1.16541 WP_001295163.1.1655 WP_001295163.1.16577 WP_001295163.1.16592 WP_001295163.1.16612 WP_001295163.1.16648 WP_001295163.1.16682 WP_001295163.1.16715 WP_001295163.1.16721 WP_001295163.1.16752 WP_001295163.1.16992 WP_001295163.1.17018 WP_001295163.1.17087 WP_001295163.1.17111 WP_001295163.1.17114 WP_001295163.1.17123 WP_001295163.1.17150 WP_001295163.1.17172 WP_001295163.1.17216 WP_001295163.1.17241 WP_001295163.1.17290 WP_001295163.1.17360 WP_001295163.1.17403 WP_001295163.1.17410 WP_001295163.1.17432 WP_001295163.1.17534 WP_001295163.1.1754 WP_001295163.1.1755 WP_001295163.1.17550 WP_001295163.1.17577 WP_001295163.1.1763 WP_001295163.1.1766 WP_001295163.1.17680 WP_001295163.1.1769 WP_001295163.1.17711 WP_001295163.1.17766 WP_001295163.1.17829 WP_001295163.1.17831 WP_001295163.1.17889 WP_001295163.1.17961 WP_001295163.1.18000 WP_001295163.1.18006 WP_001295163.1.18050 WP_001295163.1.18133 WP_001295163.1.18134 WP_001295163.1.18164 WP_001295163.1.18175 WP_001295163.1.18226 WP_001295163.1.18229 WP_001295163.1.18329 WP_001295163.1.18338 WP_001295163.1.18381 WP_001295163.1.18402 WP_001295163.1.1844 WP_001295163.1.18550 WP_001295163.1.18588 WP_001295163.1.18649 WP_001295163.1.1866 WP_001295163.1.18666 WP_001295163.1.1867 WP_001295163.1.18699 WP_001295163.1.18714 WP_001295163.1.18726 WP_001295163.1.18858 WP_001295163.1.18876 WP_001295163.1.18929 WP_001295163.1.18983 WP_001295163.1.19024 WP_001295163.1.1906 WP_001295163.1.19090 WP_001295163.1.19100 WP_001295163.1.19114 WP_001295163.1.19147 WP_001295163.1.19148 WP_001295163.1.19150 WP_001295163.1.19194 WP_001295163.1.19206 WP_001295163.1.19277 WP_001295163.1.193 WP_001295163.1.19313 WP_001295163.1.19347 WP_001295163.1.19441 WP_001295163.1.19453 WP_001295163.1.19478 WP_001295163.1.19544 WP_001295163.1.19581 WP_001295163.1.1963 WP_001295163.1.19644 WP_001295163.1.19655 WP_001295163.1.19684 WP_001295163.1.19691 WP_001295163.1.1982 WP_001295163.1.19878 WP_001295163.1.19889 WP_001295163.1.19940 WP_001295163.1.19957 WP_001295163.1.19994 WP_001295163.1.20133 WP_001295163.1.20151 WP_001295163.1.20157 WP_001295163.1.20159 WP_001295163.1.20170 WP_001295163.1.20183 WP_001295163.1.20308 WP_001295163.1.20318 WP_001295163.1.20331 WP_001295163.1.20445 WP_001295163.1.20483 WP_001295163.1.20484 WP_001295163.1.20506 WP_001295163.1.20515 WP_001295163.1.20519 WP_001295163.1.20536 WP_001295163.1.2063 WP_001295163.1.20630 WP_001295163.1.20638 WP_001295163.1.20691 WP_001295163.1.20724 WP_001295163.1.20737 WP_001295163.1.20824 WP_001295163.1.20848 WP_001295163.1.20943 WP_001295163.1.20958 WP_001295163.1.20982 WP_001295163.1.21017 WP_001295163.1.21020 WP_001295163.1.21029 WP_001295163.1.21033 WP_001295163.1.21057 WP_001295163.1.21104 WP_001295163.1.21122 WP_001295163.1.21248 WP_001295163.1.21251 WP_001295163.1.21336 WP_001295163.1.2142 WP_001295163.1.21441 WP_001295163.1.21470 WP_001295163.1.2156 WP_001295163.1.21573 WP_001295163.1.2164 WP_001295163.1.21661 WP_001295163.1.21733 WP_001295163.1.21758 WP_001295163.1.21771 WP_001295163.1.21823 WP_001295163.1.21887 WP_001295163.1.21915 WP_001295163.1.22060 WP_001295163.1.22098 WP_001295163.1.22113 WP_001295163.1.22195 WP_001295163.1.22204 WP_001295163.1.22314 WP_001295163.1.22325 WP_001295163.1.22328 WP_001295163.1.22350 WP_001295163.1.22363 WP_001295163.1.22409 WP_001295163.1.22450 WP_001295163.1.22522 WP_001295163.1.22572 WP_001295163.1.22579 WP_001295163.1.22599 WP_001295163.1.22632 WP_001295163.1.22649 WP_001295163.1.22669 WP_001295163.1.22685 WP_001295163.1.22690 WP_001295163.1.22756 WP_001295163.1.22765 WP_001295163.1.22771 WP_001295163.1.22777 WP_001295163.1.22783 WP_001295163.1.22830 WP_001295163.1.22875 WP_001295163.1.22878 WP_001295163.1.22885 WP_001295163.1.22908 WP_001295163.1.2300 WP_001295163.1.23044 WP_001295163.1.23090 WP_001295163.1.23092 WP_001295163.1.23105 WP_001295163.1.23135 WP_001295163.1.23285 WP_001295163.1.23351 WP_001295163.1.23376 WP_001295163.1.23378 WP_001295163.1.23388 WP_001295163.1.23393 WP_001295163.1.23511 WP_001295163.1.23549 WP_001295163.1.2362 WP_001295163.1.23622 WP_001295163.1.23765 WP_001295163.1.23812 WP_001295163.1.23898 WP_001295163.1.2395 WP_001295163.1.23970 WP_001295163.1.24045 WP_001295163.1.24089 WP_001295163.1.24124 WP_001295163.1.24136 WP_001295163.1.2418 WP_001295163.1.24233 WP_001295163.1.24278 WP_001295163.1.2428 WP_001295163.1.24304 WP_001295163.1.24316 WP_001295163.1.2433 WP_001295163.1.24362 WP_001295163.1.24473 WP_001295163.1.24483 WP_001295163.1.24485 WP_001295163.1.24499 WP_001295163.1.24536 WP_001295163.1.24547 WP_001295163.1.24575 WP_001295163.1.24583 WP_001295163.1.24616 WP_001295163.1.24693 WP_001295163.1.24695 WP_001295163.1.24876 WP_001295163.1.24899 WP_001295163.1.25038 WP_001295163.1.25042 WP_001295163.1.25050 WP_001295163.1.25085 WP_001295163.1.25126 WP_001295163.1.25141 WP_001295163.1.25183 WP_001295163.1.25203 WP_001295163.1.2531 WP_001295163.1.25312 WP_001295163.1.25324 WP_001295163.1.25525 WP_001295163.1.25643 WP_001295163.1.25713 WP_001295163.1.25799 WP_001295163.1.25843 WP_001295163.1.2588 WP_001295163.1.25996 WP_001295163.1.26005 WP_001295163.1.26048 WP_001295163.1.26055 WP_001295163.1.26100 WP_001295163.1.26130 WP_001295163.1.26270 WP_001295163.1.26325 WP_001295163.1.26379 WP_001295163.1.26401 WP_001295163.1.26403 WP_001295163.1.2642 WP_001295163.1.26479 WP_001295163.1.26480 WP_001295163.1.26517 WP_001295163.1.26569 WP_001295163.1.26588 WP_001295163.1.26598 WP_001295163.1.26609 WP_001295163.1.26613 WP_001295163.1.26644 WP_001295163.1.26683 WP_001295163.1.26716 WP_001295163.1.26736 WP_001295163.1.26912 WP_001295163.1.26941 WP_001295163.1.27057 WP_001295163.1.27060 WP_001295163.1.2712 WP_001295163.1.27134 WP_001295163.1.27175 WP_001295163.1.27214 WP_001295163.1.27260 WP_001295163.1.27280 WP_001295163.1.27283 WP_001295163.1.27292 WP_001295163.1.27367 WP_001295163.1.27451 WP_001295163.1.27504 WP_001295163.1.2755 WP_001295163.1.27560 WP_001295163.1.27611 WP_001295163.1.27742 WP_001295163.1.27749 WP_001295163.1.27774 WP_001295163.1.27856 WP_001295163.1.27879 WP_001295163.1.27923 WP_001295163.1.27957 WP_001295163.1.28109 WP_001295163.1.28110 WP_001295163.1.28128 WP_001295163.1.2823 WP_001295163.1.28250 WP_001295163.1.28268 WP_001295163.1.28271 WP_001295163.1.28371 WP_001295163.1.28491 WP_001295163.1.28496 WP_001295163.1.28509 WP_001295163.1.28523 WP_001295163.1.28540 WP_001295163.1.28544 WP_001295163.1.28683 WP_001295163.1.28697 WP_001295163.1.28711 WP_001295163.1.28760 WP_001295163.1.28809 WP_001295163.1.28919 WP_001295163.1.28982 WP_001295163.1.28994 WP_001295163.1.290 WP_001295163.1.29001 WP_001295163.1.29013 WP_001295163.1.29016 WP_001295163.1.29026 WP_001295163.1.29061 WP_001295163.1.29100 WP_001295163.1.29118 WP_001295163.1.29128 WP_001295163.1.29202 WP_001295163.1.29206 WP_001295163.1.29221 WP_001295163.1.2926 WP_001295163.1.2931 WP_001295163.1.2942 WP_001295163.1.2945 WP_001295163.1.29683 WP_001295163.1.29746 WP_001295163.1.29752 WP_001295163.1.2995 WP_001295163.1.29967 WP_001295163.1.30123 WP_001295163.1.30231 WP_001295163.1.30247 WP_001295163.1.30253 WP_001295163.1.30479 WP_001295163.1.30497 WP_001295163.1.30546 WP_001295163.1.30630 WP_001295163.1.30639 WP_001295163.1.30640 WP_001295163.1.30733 WP_001295163.1.30742 WP_001295163.1.30749 WP_001295163.1.30783 WP_001295163.1.30853 WP_001295163.1.31000 WP_001295163.1.31009 WP_001295163.1.31089 WP_001295163.1.31142 WP_001295163.1.31211 WP_001295163.1.31347 WP_001295163.1.31379 WP_001295163.1.31407 WP_001295163.1.31421 WP_001295163.1.31431 WP_001295163.1.31506 WP_001295163.1.31521 WP_001295163.1.31614 WP_001295163.1.31681 WP_001295163.1.3169 WP_001295163.1.31803 WP_001295163.1.3181 WP_001295163.1.31833 WP_001295163.1.31839 WP_001295163.1.31860 WP_001295163.1.31898 WP_001295163.1.31928 WP_001295163.1.32037 WP_001295163.1.32089 WP_001295163.1.32093 WP_001295163.1.3212 WP_001295163.1.32121 WP_001295163.1.32127 WP_001295163.1.32143 WP_001295163.1.32234 WP_001295163.1.32236 WP_001295163.1.32394 WP_001295163.1.32443 WP_001295163.1.32479 WP_001295163.1.32494 WP_001295163.1.32509 WP_001295163.1.32561 WP_001295163.1.32591 WP_001295163.1.32709 WP_001295163.1.32724 WP_001295163.1.32815 WP_001295163.1.32903 WP_001295163.1.32946 WP_001295163.1.32972 WP_001295163.1.32984 WP_001295163.1.33004 WP_001295163.1.33014 WP_001295163.1.33018 WP_001295163.1.33022 WP_001295163.1.33238 WP_001295163.1.33244 WP_001295163.1.33325 WP_001295163.1.33341 WP_001295163.1.33385 WP_001295163.1.334 WP_001295163.1.33408 WP_001295163.1.33422 WP_001295163.1.33424 WP_001295163.1.33502 WP_001295163.1.33526 WP_001295163.1.33631 WP_001295163.1.33638 WP_001295163.1.33648 WP_001295163.1.33736 WP_001295163.1.33746 WP_001295163.1.33751 WP_001295163.1.33799 WP_001295163.1.33853 WP_001295163.1.33854 WP_001295163.1.33879 WP_001295163.1.33888 WP_001295163.1.33952 WP_001295163.1.33974 WP_001295163.1.3398 WP_001295163.1.3401 WP_001295163.1.34032 WP_001295163.1.34094 WP_001295163.1.34122 WP_001295163.1.34124 WP_001295163.1.342 WP_001295163.1.34277 WP_001295163.1.34332 WP_001295163.1.34341 WP_001295163.1.34363 WP_001295163.1.3444 WP_001295163.1.34444 WP_001295163.1.34464 WP_001295163.1.34525 WP_001295163.1.34532 WP_001295163.1.34538 WP_001295163.1.34605 WP_001295163.1.347 WP_001295163.1.34727 WP_001295163.1.34782 WP_001295163.1.34855 WP_001295163.1.34948 WP_001295163.1.34982 WP_001295163.1.34990 WP_001295163.1.34993 WP_001295163.1.35006 WP_001295163.1.35180 WP_001295163.1.35195 WP_001295163.1.35204 WP_001295163.1.35211 WP_001295163.1.35360 WP_001295163.1.35365 WP_001295163.1.35368 WP_001295163.1.35376 WP_001295163.1.35465 WP_001295163.1.35466 WP_001295163.1.35468 WP_001295163.1.35581 WP_001295163.1.3560 WP_001295163.1.35604 WP_001295163.1.35649 WP_001295163.1.35651 WP_001295163.1.35698 WP_001295163.1.35704 WP_001295163.1.35724 WP_001295163.1.35740 WP_001295163.1.35904 WP_001295163.1.35959 WP_001295163.1.36042 WP_001295163.1.36070 WP_001295163.1.36094 WP_001295163.1.36129 WP_001295163.1.36164 WP_001295163.1.36182 WP_001295163.1.36334 WP_001295163.1.36386 WP_001295163.1.36393 WP_001295163.1.36412 WP_001295163.1.36496 WP_001295163.1.36500 WP_001295163.1.36507 WP_001295163.1.36531 WP_001295163.1.36627 WP_001295163.1.36628 WP_001295163.1.3671 WP_001295163.1.36739 WP_001295163.1.36746 WP_001295163.1.36747 WP_001295163.1.36812 WP_001295163.1.36817 WP_001295163.1.36975 WP_001295163.1.37020 WP_001295163.1.37057 WP_001295163.1.37099 WP_001295163.1.37155 WP_001295163.1.3723 WP_001295163.1.37233 WP_001295163.1.37261 WP_001295163.1.37329 WP_001295163.1.37433 WP_001295163.1.37445 WP_001295163.1.37485 WP_001295163.1.37549 WP_001295163.1.37554 WP_001295163.1.37576 WP_001295163.1.37588 WP_001295163.1.37637 WP_001295163.1.37730 WP_001295163.1.37745 WP_001295163.1.37750 WP_001295163.1.37762 WP_001295163.1.37773 WP_001295163.1.37817 WP_001295163.1.3788 WP_001295163.1.37887 WP_001295163.1.37897 WP_001295163.1.37964 WP_001295163.1.38080 WP_001295163.1.38085 WP_001295163.1.38105 WP_001295163.1.3811 WP_001295163.1.38120 WP_001295163.1.3815 WP_001295163.1.38155 WP_001295163.1.38182 WP_001295163.1.38202 WP_001295163.1.38211 WP_001295163.1.38257 WP_001295163.1.38314 WP_001295163.1.38323 WP_001295163.1.38357 WP_001295163.1.38363 WP_001295163.1.38371 WP_001295163.1.38485 WP_001295163.1.38533 WP_001295163.1.38544 WP_001295163.1.38584 WP_001295163.1.38636 WP_001295163.1.38722 WP_001295163.1.3873 WP_001295163.1.38843 WP_001295163.1.38920 WP_001295163.1.38935 WP_001295163.1.38950 WP_001295163.1.39042 WP_001295163.1.39063 WP_001295163.1.39164 WP_001295163.1.39167 WP_001295163.1.39171 WP_001295163.1.39249 WP_001295163.1.39342 WP_001295163.1.39356 WP_001295163.1.39358 WP_001295163.1.39365 WP_001295163.1.39367 WP_001295163.1.39430 WP_001295163.1.39481 WP_001295163.1.39531 WP_001295163.1.39541 WP_001295163.1.39594 WP_001295163.1.39606 WP_001295163.1.39607 WP_001295163.1.39690 WP_001295163.1.3980 WP_001295163.1.39818 WP_001295163.1.39829 WP_001295163.1.39870 WP_001295163.1.39938 WP_001295163.1.39961 WP_001295163.1.39966 WP_001295163.1.39992 WP_001295163.1.39998 WP_001295163.1.40013 WP_001295163.1.40016 WP_001295163.1.40088 WP_001295163.1.40192 WP_001295163.1.4020 WP_001295163.1.40212 WP_001295163.1.40218 WP_001295163.1.40238 WP_001295163.1.40315 WP_001295163.1.40317 WP_001295163.1.40389 WP_001295163.1.40403 WP_001295163.1.40445 WP_001295163.1.4049 WP_001295163.1.40499 WP_001295163.1.40524 WP_001295163.1.40548 WP_001295163.1.40563 WP_001295163.1.40596 WP_001295163.1.406 WP_001295163.1.40666 WP_001295163.1.40712 WP_001295163.1.40815 WP_001295163.1.40833 WP_001295163.1.40865 WP_001295163.1.40898 WP_001295163.1.40912 WP_001295163.1.40937 WP_001295163.1.40965 WP_001295163.1.41147 WP_001295163.1.41206 WP_001295163.1.4126 WP_001295163.1.41315 WP_001295163.1.41339 WP_001295163.1.41346 WP_001295163.1.41363 WP_001295163.1.41368 WP_001295163.1.41371 WP_001295163.1.41372 WP_001295163.1.41391 WP_001295163.1.41417 WP_001295163.1.4142 WP_001295163.1.41436 WP_001295163.1.41449 WP_001295163.1.41484 WP_001295163.1.41513 WP_001295163.1.41530 WP_001295163.1.41539 WP_001295163.1.41556 WP_001295163.1.41566 WP_001295163.1.41621 WP_001295163.1.41651 WP_001295163.1.41654 WP_001295163.1.41740 WP_001295163.1.41752 WP_001295163.1.41782 WP_001295163.1.41812 WP_001295163.1.41813 WP_001295163.1.41826 WP_001295163.1.41900 WP_001295163.1.41960 WP_001295163.1.41988 WP_001295163.1.42022 WP_001295163.1.42073 WP_001295163.1.42113 WP_001295163.1.42159 WP_001295163.1.42179 WP_001295163.1.42209 WP_001295163.1.42214 WP_001295163.1.42233 WP_001295163.1.4224 WP_001295163.1.42318 WP_001295163.1.42376 WP_001295163.1.42432 WP_001295163.1.42448 WP_001295163.1.42669 WP_001295163.1.42749 WP_001295163.1.42756 WP_001295163.1.42770 WP_001295163.1.4282 WP_001295163.1.42879 WP_001295163.1.4290 WP_001295163.1.42918 WP_001295163.1.42936 WP_001295163.1.42962 WP_001295163.1.42989 WP_001295163.1.43035 WP_001295163.1.4306 WP_001295163.1.43133 WP_001295163.1.43137 WP_001295163.1.43177 WP_001295163.1.43239 WP_001295163.1.43270 WP_001295163.1.43363 WP_001295163.1.43389 WP_001295163.1.43473 WP_001295163.1.43489 WP_001295163.1.43561 WP_001295163.1.43598 WP_001295163.1.43622 WP_001295163.1.43720 WP_001295163.1.43750 WP_001295163.1.43804 WP_001295163.1.43925 WP_001295163.1.44020 WP_001295163.1.44029 WP_001295163.1.44040 WP_001295163.1.44088 WP_001295163.1.44096 WP_001295163.1.44100 WP_001295163.1.44115 WP_001295163.1.44162 WP_001295163.1.44166 WP_001295163.1.44211 WP_001295163.1.44222 WP_001295163.1.44273 WP_001295163.1.44365 WP_001295163.1.44445 WP_001295163.1.4445 WP_001295163.1.44458 WP_001295163.1.4449 WP_001295163.1.44558 WP_001295163.1.44610 WP_001295163.1.44627 WP_001295163.1.44671 WP_001295163.1.44724 WP_001295163.1.44756 WP_001295163.1.44821 WP_001295163.1.44841 WP_001295163.1.44849 WP_001295163.1.44854 WP_001295163.1.44923 WP_001295163.1.44960 WP_001295163.1.44970 WP_001295163.1.44980 WP_001295163.1.45028 WP_001295163.1.45043 WP_001295163.1.45053 WP_001295163.1.4516 WP_001295163.1.45208 WP_001295163.1.45246 WP_001295163.1.45313 WP_001295163.1.45329 WP_001295163.1.4535 WP_001295163.1.45392 WP_001295163.1.45440 WP_001295163.1.45444 WP_001295163.1.4549 WP_001295163.1.45581 WP_001295163.1.45595 WP_001295163.1.4570 WP_001295163.1.4574 WP_001295163.1.45741 WP_001295163.1.45752 WP_001295163.1.45799 WP_001295163.1.4593 WP_001295163.1.45933 WP_001295163.1.45945 WP_001295163.1.45949 WP_001295163.1.45968 WP_001295163.1.46026 WP_001295163.1.46048 WP_001295163.1.46070 WP_001295163.1.46097 WP_001295163.1.46115 WP_001295163.1.46197 WP_001295163.1.46213 WP_001295163.1.46257 WP_001295163.1.46301 WP_001295163.1.46325 WP_001295163.1.46329 WP_001295163.1.46429 WP_001295163.1.46441 WP_001295163.1.4646 WP_001295163.1.46477 WP_001295163.1.46526 WP_001295163.1.46573 WP_001295163.1.46582 WP_001295163.1.46602 WP_001295163.1.46614 WP_001295163.1.46616 WP_001295163.1.46643 WP_001295163.1.4670 WP_001295163.1.46802 WP_001295163.1.46820 WP_001295163.1.46821 WP_001295163.1.46876 WP_001295163.1.46909 WP_001295163.1.4691 WP_001295163.1.46932 WP_001295163.1.47029 WP_001295163.1.47048 WP_001295163.1.47050 WP_001295163.1.47063 WP_001295163.1.47069 WP_001295163.1.47156 WP_001295163.1.4722 WP_001295163.1.47224 WP_001295163.1.47322 WP_001295163.1.47332 WP_001295163.1.47356 WP_001295163.1.47386 WP_001295163.1.4740 WP_001295163.1.47401 WP_001295163.1.47496 WP_001295163.1.47555 WP_001295163.1.47634 WP_001295163.1.47646 WP_001295163.1.47673 WP_001295163.1.4772 WP_001295163.1.47734 WP_001295163.1.47740 WP_001295163.1.47761 WP_001295163.1.47764 WP_001295163.1.47765 WP_001295163.1.47770 WP_001295163.1.47775 WP_001295163.1.47848 WP_001295163.1.4785 WP_001295163.1.47962 WP_001295163.1.48040 WP_001295163.1.48048 WP_001295163.1.48073 WP_001295163.1.48080 WP_001295163.1.48096 WP_001295163.1.48111 WP_001295163.1.48188 WP_001295163.1.48194 WP_001295163.1.48203 WP_001295163.1.48290 WP_001295163.1.48353 WP_001295163.1.48371 WP_001295163.1.48385 WP_001295163.1.48477 WP_001295163.1.48505 WP_001295163.1.48522 WP_001295163.1.4857 WP_001295163.1.4871 WP_001295163.1.48847 WP_001295163.1.48860 WP_001295163.1.48926 WP_001295163.1.48953 WP_001295163.1.48974 WP_001295163.1.49009 WP_001295163.1.49124 WP_001295163.1.49147 WP_001295163.1.49236 WP_001295163.1.49312 WP_001295163.1.49363 WP_001295163.1.49482 WP_001295163.1.49531 WP_001295163.1.49537 WP_001295163.1.49621 WP_001295163.1.49645 WP_001295163.1.49661 WP_001295163.1.497 WP_001295163.1.49733 WP_001295163.1.49740 WP_001295163.1.49768 WP_001295163.1.49774 WP_001295163.1.49823 WP_001295163.1.49861 WP_001295163.1.49883 WP_001295163.1.49900 WP_001295163.1.49954 WP_001295163.1.49987 WP_001295163.1.50006 WP_001295163.1.50008 WP_001295163.1.50078 WP_001295163.1.50113 WP_001295163.1.5017 WP_001295163.1.50262 WP_001295163.1.50266 WP_001295163.1.50361 WP_001295163.1.50412 WP_001295163.1.50418 WP_001295163.1.50452 WP_001295163.1.5056 WP_001295163.1.50564 WP_001295163.1.50579 WP_001295163.1.5064 WP_001295163.1.5067 WP_001295163.1.50717 WP_001295163.1.50939 WP_001295163.1.5095 WP_001295163.1.50996 WP_001295163.1.51042 WP_001295163.1.51058 WP_001295163.1.5106 WP_001295163.1.51109 WP_001295163.1.51172 WP_001295163.1.51206 WP_001295163.1.5128 WP_001295163.1.51300 WP_001295163.1.51323 WP_001295163.1.51325 WP_001295163.1.51380 WP_001295163.1.51425 WP_001295163.1.51430 WP_001295163.1.51441 WP_001295163.1.5146 WP_001295163.1.51490 WP_001295163.1.51495 WP_001295163.1.51525 WP_001295163.1.51539 WP_001295163.1.51548 WP_001295163.1.51552 WP_001295163.1.51587 WP_001295163.1.51600 WP_001295163.1.51607 WP_001295163.1.51784 WP_001295163.1.51837 WP_001295163.1.51873 WP_001295163.1.51968 WP_001295163.1.51999 WP_001295163.1.52002 WP_001295163.1.52020 WP_001295163.1.52076 WP_001295163.1.52135 WP_001295163.1.52171 WP_001295163.1.52200 WP_001295163.1.52211 WP_001295163.1.52214 WP_001295163.1.52243 WP_001295163.1.52249 WP_001295163.1.5227 WP_001295163.1.52305 WP_001295163.1.5239 WP_001295163.1.52399 WP_001295163.1.52406 WP_001295163.1.52419 WP_001295163.1.52421 WP_001295163.1.52492 WP_001295163.1.52524 WP_001295163.1.52544 WP_001295163.1.52558 WP_001295163.1.52612 WP_001295163.1.5265 WP_001295163.1.52691 WP_001295163.1.5272 WP_001295163.1.52774 WP_001295163.1.52780 WP_001295163.1.52844 WP_001295163.1.52852 WP_001295163.1.52853 WP_001295163.1.52895 WP_001295163.1.52908 WP_001295163.1.5291 WP_001295163.1.52913 WP_001295163.1.52962 WP_001295163.1.53012 WP_001295163.1.53020 WP_001295163.1.53027 WP_001295163.1.53095 WP_001295163.1.53110 WP_001295163.1.532 WP_001295163.1.53242 WP_001295163.1.53244 WP_001295163.1.53327 WP_001295163.1.53377 WP_001295163.1.5342 WP_001295163.1.53428 WP_001295163.1.53505 WP_001295163.1.53545 WP_001295163.1.53592 WP_001295163.1.53645 WP_001295163.1.53841 WP_001295163.1.53863 WP_001295163.1.53931 WP_001295163.1.53972 WP_001295163.1.53994 WP_001295163.1.54002 WP_001295163.1.54013 WP_001295163.1.54023 WP_001295163.1.54028 WP_001295163.1.54144 WP_001295163.1.54202 WP_001295163.1.54263 WP_001295163.1.54328 WP_001295163.1.54329 WP_001295163.1.54344 WP_001295163.1.54359 WP_001295163.1.54463 WP_001295163.1.54476 WP_001295163.1.54507 WP_001295163.1.54546 WP_001295163.1.54591 WP_001295163.1.5460 WP_001295163.1.54602 WP_001295163.1.54617 WP_001295163.1.54620 WP_001295163.1.54625 WP_001295163.1.54695 WP_001295163.1.5470 WP_001295163.1.54755 WP_001295163.1.5479 WP_001295163.1.54798 WP_001295163.1.54817 WP_001295163.1.54829 WP_001295163.1.54927 WP_001295163.1.54941 WP_001295163.1.54981 WP_001295163.1.54989 WP_001295163.1.55003 WP_001295163.1.55005 WP_001295163.1.55009 WP_001295163.1.55041 WP_001295163.1.55070 WP_001295163.1.55112 WP_001295163.1.55115 WP_001295163.1.55123 WP_001295163.1.55203 WP_001295163.1.55226 WP_001295163.1.55291 WP_001295163.1.55338 WP_001295163.1.55342 WP_001295163.1.55374 WP_001295163.1.55417 WP_001295163.1.55424 WP_001295163.1.55425 WP_001295163.1.55466 WP_001295163.1.55489 WP_001295163.1.55507 WP_001295163.1.55529 WP_001295163.1.55551 WP_001295163.1.55556 WP_001295163.1.55560 WP_001295163.1.55574 WP_001295163.1.5561 WP_001295163.1.55629 WP_001295163.1.55676 WP_001295163.1.55709 WP_001295163.1.55720 WP_001295163.1.55730 WP_001295163.1.55787 WP_001295163.1.55825 WP_001295163.1.55868 WP_001295163.1.561 WP_001295163.1.5614 WP_001295163.1.56149 WP_001295163.1.56164 WP_001295163.1.56197 WP_001295163.1.56285 WP_001295163.1.56302 WP_001295163.1.56358 WP_001295163.1.56436 WP_001295163.1.56528 WP_001295163.1.56689 WP_001295163.1.56742 WP_001295163.1.56786 WP_001295163.1.56789 WP_001295163.1.56799 WP_001295163.1.56830 WP_001295163.1.56846 WP_001295163.1.5685 WP_001295163.1.56871 WP_001295163.1.56932 WP_001295163.1.56978 WP_001295163.1.56980 WP_001295163.1.57100 WP_001295163.1.57124 WP_001295163.1.57150 WP_001295163.1.57181 WP_001295163.1.57222 WP_001295163.1.57348 WP_001295163.1.57386 WP_001295163.1.57395 WP_001295163.1.57401 WP_001295163.1.57403 WP_001295163.1.57410 WP_001295163.1.57414 WP_001295163.1.57432 WP_001295163.1.57487 WP_001295163.1.57558 WP_001295163.1.57629 WP_001295163.1.57638 WP_001295163.1.57719 WP_001295163.1.57846 WP_001295163.1.5786 WP_001295163.1.57904 WP_001295163.1.58060 WP_001295163.1.58080 WP_001295163.1.5810 WP_001295163.1.58136 WP_001295163.1.58226 WP_001295163.1.58232 WP_001295163.1.58267 WP_001295163.1.58316 WP_001295163.1.58401 WP_001295163.1.5842 WP_001295163.1.58420 WP_001295163.1.58429 WP_001295163.1.58440 WP_001295163.1.58445 WP_001295163.1.58475 WP_001295163.1.58507 WP_001295163.1.58514 WP_001295163.1.58528 WP_001295163.1.58572 WP_001295163.1.58837 WP_001295163.1.58867 WP_001295163.1.58870 WP_001295163.1.58940 WP_001295163.1.58951 WP_001295163.1.58958 WP_001295163.1.58976 WP_001295163.1.59024 WP_001295163.1.59026 WP_001295163.1.59035 WP_001295163.1.59047 WP_001295163.1.59165 WP_001295163.1.59226 WP_001295163.1.59293 WP_001295163.1.59306 WP_001295163.1.59395 WP_001295163.1.59407 WP_001295163.1.59409 WP_001295163.1.59413 WP_001295163.1.59434 WP_001295163.1.59513 WP_001295163.1.59533 WP_001295163.1.59553 WP_001295163.1.59590 WP_001295163.1.59615 WP_001295163.1.59638 WP_001295163.1.5965 WP_001295163.1.59699 WP_001295163.1.59717 WP_001295163.1.59730 WP_001295163.1.59756 WP_001295163.1.59781 WP_001295163.1.59823 WP_001295163.1.59836 WP_001295163.1.59998 WP_001295163.1.6002 WP_001295163.1.60031 WP_001295163.1.60067 WP_001295163.1.60095 WP_001295163.1.60151 WP_001295163.1.60228 WP_001295163.1.60325 WP_001295163.1.60342 WP_001295163.1.60343 WP_001295163.1.60387 WP_001295163.1.60477 WP_001295163.1.60498 WP_001295163.1.60505 WP_001295163.1.60550 WP_001295163.1.60567 WP_001295163.1.60576 WP_001295163.1.6061 WP_001295163.1.6066 WP_001295163.1.60717 WP_001295163.1.60764 WP_001295163.1.60895 WP_001295163.1.60901 WP_001295163.1.60927 WP_001295163.1.61005 WP_001295163.1.61046 WP_001295163.1.61096 WP_001295163.1.61102 WP_001295163.1.61170 WP_001295163.1.61181 WP_001295163.1.61183 WP_001295163.1.61225 WP_001295163.1.61241 WP_001295163.1.61292 WP_001295163.1.61505 WP_001295163.1.61512 WP_001295163.1.61517 WP_001295163.1.61551 WP_001295163.1.61608 WP_001295163.1.61636 WP_001295163.1.61663 WP_001295163.1.61758 WP_001295163.1.61770 WP_001295163.1.61779 WP_001295163.1.61822 WP_001295163.1.61949 WP_001295163.1.62041 WP_001295163.1.62099 WP_001295163.1.6212 WP_001295163.1.62273 WP_001295163.1.62296 WP_001295163.1.62447 WP_001295163.1.62612 WP_001295163.1.62642 WP_001295163.1.62668 WP_001295163.1.62681 WP_001295163.1.62714 WP_001295163.1.62735 WP_001295163.1.62750 WP_001295163.1.62762 WP_001295163.1.62787 WP_001295163.1.62812 WP_001295163.1.62840 WP_001295163.1.62850 WP_001295163.1.62914 WP_001295163.1.62919 WP_001295163.1.6293 WP_001295163.1.62959 WP_001295163.1.62989 WP_001295163.1.63167 WP_001295163.1.63189 WP_001295163.1.6323 WP_001295163.1.63246 WP_001295163.1.63287 WP_001295163.1.63350 WP_001295163.1.6337 WP_001295163.1.63370 WP_001295163.1.63374 WP_001295163.1.63393 WP_001295163.1.63453 WP_001295163.1.63478 WP_001295163.1.63556 WP_001295163.1.63576 WP_001295163.1.63612 WP_001295163.1.63679 WP_001295163.1.63703 WP_001295163.1.63721 WP_001295163.1.63746 WP_001295163.1.63964 WP_001295163.1.64008 WP_001295163.1.64040 WP_001295163.1.64080 WP_001295163.1.64110 WP_001295163.1.64153 WP_001295163.1.6416 WP_001295163.1.64285 WP_001295163.1.64286 WP_001295163.1.64321 WP_001295163.1.64337 WP_001295163.1.64353 WP_001295163.1.64380 WP_001295163.1.6441 WP_001295163.1.64438 WP_001295163.1.64448 WP_001295163.1.64458 WP_001295163.1.64519 WP_001295163.1.64746 WP_001295163.1.64749 WP_001295163.1.64784 WP_001295163.1.64789 WP_001295163.1.64793 WP_001295163.1.64912 WP_001295163.1.64926 WP_001295163.1.64930 WP_001295163.1.6499 WP_001295163.1.65023 WP_001295163.1.65040 WP_001295163.1.65097 WP_001295163.1.651 WP_001295163.1.65206 WP_001295163.1.65256 WP_001295163.1.65271 WP_001295163.1.65353 WP_001295163.1.65364 WP_001295163.1.6537 WP_001295163.1.654 WP_001295163.1.65415 WP_001295163.1.65484 WP_001295163.1.65662 WP_001295163.1.65672 WP_001295163.1.65912 WP_001295163.1.65961 WP_001295163.1.6599 WP_001295163.1.66001 WP_001295163.1.66007 WP_001295163.1.66050 WP_001295163.1.66104 WP_001295163.1.66105 WP_001295163.1.66127 WP_001295163.1.66181 WP_001295163.1.66197 WP_001295163.1.66251 WP_001295163.1.66280 WP_001295163.1.66327 WP_001295163.1.6635 WP_001295163.1.66387 WP_001295163.1.66389 WP_001295163.1.66395 WP_001295163.1.6645 WP_001295163.1.66501 WP_001295163.1.6654 WP_001295163.1.66550 WP_001295163.1.66559 WP_001295163.1.66644 WP_001295163.1.6665 WP_001295163.1.66700 WP_001295163.1.66719 WP_001295163.1.6676 WP_001295163.1.66795 WP_001295163.1.66926 WP_001295163.1.66933 WP_001295163.1.66978 WP_001295163.1.6701 WP_001295163.1.67021 WP_001295163.1.67022 WP_001295163.1.67116 WP_001295163.1.67137 WP_001295163.1.67194 WP_001295163.1.67200 WP_001295163.1.67209 WP_001295163.1.67272 WP_001295163.1.67293 WP_001295163.1.67383 WP_001295163.1.67412 WP_001295163.1.67454 WP_001295163.1.67468 WP_001295163.1.67549 WP_001295163.1.67553 WP_001295163.1.67724 WP_001295163.1.67732 WP_001295163.1.67786 WP_001295163.1.67787 WP_001295163.1.67788 WP_001295163.1.67802 WP_001295163.1.67841 WP_001295163.1.67853 WP_001295163.1.67971 WP_001295163.1.67975 WP_001295163.1.67999 WP_001295163.1.68008 WP_001295163.1.68011 WP_001295163.1.68025 WP_001295163.1.6814 WP_001295163.1.68170 WP_001295163.1.68175 WP_001295163.1.68215 WP_001295163.1.68278 WP_001295163.1.68283 WP_001295163.1.68336 WP_001295163.1.68341 WP_001295163.1.68347 WP_001295163.1.68396 WP_001295163.1.68442 WP_001295163.1.68534 WP_001295163.1.68566 WP_001295163.1.68695 WP_001295163.1.68697 WP_001295163.1.68711 WP_001295163.1.6877 WP_001295163.1.68797 WP_001295163.1.68801 WP_001295163.1.68865 WP_001295163.1.68915 WP_001295163.1.68956 WP_001295163.1.6897 WP_001295163.1.68989 WP_001295163.1.69033 WP_001295163.1.69098 WP_001295163.1.69127 WP_001295163.1.69144 WP_001295163.1.6916 WP_001295163.1.6923 WP_001295163.1.69247 WP_001295163.1.69258 WP_001295163.1.69261 WP_001295163.1.69303 WP_001295163.1.69305 WP_001295163.1.69390 WP_001295163.1.6945 WP_001295163.1.69473 WP_001295163.1.69583 WP_001295163.1.69646 WP_001295163.1.69649 WP_001295163.1.69803 WP_001295163.1.69868 WP_001295163.1.6993 WP_001295163.1.70191 WP_001295163.1.70251 WP_001295163.1.70341 WP_001295163.1.70370 WP_001295163.1.70407 WP_001295163.1.70492 WP_001295163.1.7052 WP_001295163.1.70578 WP_001295163.1.70592 WP_001295163.1.70748 WP_001295163.1.70767 WP_001295163.1.70794 WP_001295163.1.70880 WP_001295163.1.7090 WP_001295163.1.70900 WP_001295163.1.70967 WP_001295163.1.71024 WP_001295163.1.71062 WP_001295163.1.71158 WP_001295163.1.71159 WP_001295163.1.71192 WP_001295163.1.71199 WP_001295163.1.71229 WP_001295163.1.71272 WP_001295163.1.71285 WP_001295163.1.71315 WP_001295163.1.71323 WP_001295163.1.71354 WP_001295163.1.71397 WP_001295163.1.71403 WP_001295163.1.71409 WP_001295163.1.71522 WP_001295163.1.71533 WP_001295163.1.71537 WP_001295163.1.71603 WP_001295163.1.71632 WP_001295163.1.71690 WP_001295163.1.71724 WP_001295163.1.71783 WP_001295163.1.7192 WP_001295163.1.71938 WP_001295163.1.71944 WP_001295163.1.71975 WP_001295163.1.71993 WP_001295163.1.72021 WP_001295163.1.72033 WP_001295163.1.7205 WP_001295163.1.7210 WP_001295163.1.72157 WP_001295163.1.72184 WP_001295163.1.72237 WP_001295163.1.72240 WP_001295163.1.72279 WP_001295163.1.72337 WP_001295163.1.72342 WP_001295163.1.72397 WP_001295163.1.72431 WP_001295163.1.72449 WP_001295163.1.72485 WP_001295163.1.72511 WP_001295163.1.72521 WP_001295163.1.72537 WP_001295163.1.72544 WP_001295163.1.72608 WP_001295163.1.72616 WP_001295163.1.72652 WP_001295163.1.72663 WP_001295163.1.72695 WP_001295163.1.72698 WP_001295163.1.72725 WP_001295163.1.72729 WP_001295163.1.72745 WP_001295163.1.72747 WP_001295163.1.72748 WP_001295163.1.72758 WP_001295163.1.72837 WP_001295163.1.72860 WP_001295163.1.72869 WP_001295163.1.72910 WP_001295163.1.72947 WP_001295163.1.7307 WP_001295163.1.73085 WP_001295163.1.73129 WP_001295163.1.73217 WP_001295163.1.73249 WP_001295163.1.73251 WP_001295163.1.73257 WP_001295163.1.73292 WP_001295163.1.73295 WP_001295163.1.73340 WP_001295163.1.73349 WP_001295163.1.73385 WP_001295163.1.73524 WP_001295163.1.73604 WP_001295163.1.73717 WP_001295163.1.73743 WP_001295163.1.73835 WP_001295163.1.73843 WP_001295163.1.73844 WP_001295163.1.73859 WP_001295163.1.73908 WP_001295163.1.73942 WP_001295163.1.73992 WP_001295163.1.74123 WP_001295163.1.74184 WP_001295163.1.7424 WP_001295163.1.7425 WP_001295163.1.74309 WP_001295163.1.74444 WP_001295163.1.74445 WP_001295163.1.74509 WP_001295163.1.74513 WP_001295163.1.74520 WP_001295163.1.74528 WP_001295163.1.7461 WP_001295163.1.74624 WP_001295163.1.74625 WP_001295163.1.74670 WP_001295163.1.74687 WP_001295163.1.74688 WP_001295163.1.74691 WP_001295163.1.74713 WP_001295163.1.74735 WP_001295163.1.7475 WP_001295163.1.7478 WP_001295163.1.74854 WP_001295163.1.74889 WP_001295163.1.74998 WP_001295163.1.75021 WP_001295163.1.75124 WP_001295163.1.75139 WP_001295163.1.75145 WP_001295163.1.75209 WP_001295163.1.75243 WP_001295163.1.75367 WP_001295163.1.75428 WP_001295163.1.75491 WP_001295163.1.75505 WP_001295163.1.75515 WP_001295163.1.75529 WP_001295163.1.75537 WP_001295163.1.75594 WP_001295163.1.75612 WP_001295163.1.75644 WP_001295163.1.75672 WP_001295163.1.75679 WP_001295163.1.75687 WP_001295163.1.75696 WP_001295163.1.75699 WP_001295163.1.75735 WP_001295163.1.75758 WP_001295163.1.75853 WP_001295163.1.75983 WP_001295163.1.75995 WP_001295163.1.75999 WP_001295163.1.76009 WP_001295163.1.76039 WP_001295163.1.76184 WP_001295163.1.76196 WP_001295163.1.76211 WP_001295163.1.76325 WP_001295163.1.76361 WP_001295163.1.76384 WP_001295163.1.76446 WP_001295163.1.76447 WP_001295163.1.76460 WP_001295163.1.76462 WP_001295163.1.76547 WP_001295163.1.76656 WP_001295163.1.76701 WP_001295163.1.76815 WP_001295163.1.76840 WP_001295163.1.76909 WP_001295163.1.76918 WP_001295163.1.76933 WP_001295163.1.76948 WP_001295163.1.76957 WP_001295163.1.77070 WP_001295163.1.77162 WP_001295163.1.77163 WP_001295163.1.77175 WP_001295163.1.77198 WP_001295163.1.77214 WP_001295163.1.77255 WP_001295163.1.77284 WP_001295163.1.77291 WP_001295163.1.77341 WP_001295163.1.77358 WP_001295163.1.77437 WP_001295163.1.77452 WP_001295163.1.77462 WP_001295163.1.77470 WP_001295163.1.77471 WP_001295163.1.77477 WP_001295163.1.77503 WP_001295163.1.77626 WP_001295163.1.77636 WP_001295163.1.77648 WP_001295163.1.77768 WP_001295163.1.77833 WP_001295163.1.77876 WP_001295163.1.77929 WP_001295163.1.77949 WP_001295163.1.77999 WP_001295163.1.78000 WP_001295163.1.78007 WP_001295163.1.78089 WP_001295163.1.78102 WP_001295163.1.78196 WP_001295163.1.78235 WP_001295163.1.78321 WP_001295163.1.78337 WP_001295163.1.78377 WP_001295163.1.78413 WP_001295163.1.78445 WP_001295163.1.78462 WP_001295163.1.7847 WP_001295163.1.78583 WP_001295163.1.78612 WP_001295163.1.78615 WP_001295163.1.78645 WP_001295163.1.78683 WP_001295163.1.78687 WP_001295163.1.78718 WP_001295163.1.78750 WP_001295163.1.78791 WP_001295163.1.78888 WP_001295163.1.78919 WP_001295163.1.78953 WP_001295163.1.7896 WP_001295163.1.79004 WP_001295163.1.79067 WP_001295163.1.79086 WP_001295163.1.79306 WP_001295163.1.79312 WP_001295163.1.79346 WP_001295163.1.79356 WP_001295163.1.79369 WP_001295163.1.7937 WP_001295163.1.79391 WP_001295163.1.79478 WP_001295163.1.79505 WP_001295163.1.79519 WP_001295163.1.79558 WP_001295163.1.79685 WP_001295163.1.79764 WP_001295163.1.79800 WP_001295163.1.79816 WP_001295163.1.79840 WP_001295163.1.7987 WP_001295163.1.79871 WP_001295163.1.79877 WP_001295163.1.7993 WP_001295163.1.79930 WP_001295163.1.79936 WP_001295163.1.79984 WP_001295163.1.80050 WP_001295163.1.80060 WP_001295163.1.80106 WP_001295163.1.80136 WP_001295163.1.80179 WP_001295163.1.80183 WP_001295163.1.80255 WP_001295163.1.80320 WP_001295163.1.80426 WP_001295163.1.80428 WP_001295163.1.80440 WP_001295163.1.80444 WP_001295163.1.80463 WP_001295163.1.80517 WP_001295163.1.80524 WP_001295163.1.8057 WP_001295163.1.80612 WP_001295163.1.80626 WP_001295163.1.80662 WP_001295163.1.80756 WP_001295163.1.8076 WP_001295163.1.80768 WP_001295163.1.80804 WP_001295163.1.80805 WP_001295163.1.80884 WP_001295163.1.8090 WP_001295163.1.80966 WP_001295163.1.80983 WP_001295163.1.80985 WP_001295163.1.81026 WP_001295163.1.81034 WP_001295163.1.81036 WP_001295163.1.81054 WP_001295163.1.81127 WP_001295163.1.8121 WP_001295163.1.81286 WP_001295163.1.8129 WP_001295163.1.81316 WP_001295163.1.81391 WP_001295163.1.81576 WP_001295163.1.81577 WP_001295163.1.81580 WP_001295163.1.81582 WP_001295163.1.81589 WP_001295163.1.81618 WP_001295163.1.81625 WP_001295163.1.81715 WP_001295163.1.8172 WP_001295163.1.81806 WP_001295163.1.81832 WP_001295163.1.81869 WP_001295163.1.81876 WP_001295163.1.81935 WP_001295163.1.81939 WP_001295163.1.81956 WP_001295163.1.82074 WP_001295163.1.82239 WP_001295163.1.82246 WP_001295163.1.82275 WP_001295163.1.82316 WP_001295163.1.82326 WP_001295163.1.8235 WP_001295163.1.82439 WP_001295163.1.82507 WP_001295163.1.82536 WP_001295163.1.82626 WP_001295163.1.82647 WP_001295163.1.82691 WP_001295163.1.82700 WP_001295163.1.82715 WP_001295163.1.82754 WP_001295163.1.8277 WP_001295163.1.82853 WP_001295163.1.83020 WP_001295163.1.83035 WP_001295163.1.8308 WP_001295163.1.83093 WP_001295163.1.83097 WP_001295163.1.831 WP_001295163.1.83224 WP_001295163.1.83286 WP_001295163.1.83321 WP_001295163.1.83340 WP_001295163.1.83415 WP_001295163.1.8345 WP_001295163.1.83537 WP_001295163.1.83544 WP_001295163.1.83564 WP_001295163.1.83584 WP_001295163.1.83684 WP_001295163.1.83735 WP_001295163.1.83781 WP_001295163.1.83807 WP_001295163.1.83820 WP_001295163.1.83941 WP_001295163.1.84060 WP_001295163.1.8411 WP_001295163.1.84164 WP_001295163.1.84185 WP_001295163.1.84210 WP_001295163.1.84298 WP_001295163.1.84331 WP_001295163.1.84339 WP_001295163.1.84348 WP_001295163.1.84405 WP_001295163.1.84410 WP_001295163.1.8444 WP_001295163.1.84467 WP_001295163.1.84511 WP_001295163.1.84534 WP_001295163.1.84584 WP_001295163.1.84668 WP_001295163.1.84697 WP_001295163.1.84738 WP_001295163.1.84740 WP_001295163.1.84875 WP_001295163.1.84877 WP_001295163.1.84893 WP_001295163.1.84929 WP_001295163.1.84972 WP_001295163.1.84986 WP_001295163.1.84989 WP_001295163.1.84990 WP_001295163.1.84994 WP_001295163.1.85002 WP_001295163.1.85008 WP_001295163.1.85052 WP_001295163.1.85085 WP_001295163.1.85129 WP_001295163.1.85175 WP_001295163.1.85247 WP_001295163.1.85255 WP_001295163.1.85260 WP_001295163.1.85310 WP_001295163.1.85323 WP_001295163.1.85416 WP_001295163.1.85500 WP_001295163.1.85525 WP_001295163.1.8560 WP_001295163.1.85621 WP_001295163.1.85752 WP_001295163.1.85773 WP_001295163.1.8579 WP_001295163.1.85806 WP_001295163.1.85857 WP_001295163.1.8592 WP_001295163.1.85948 WP_001295163.1.85969 WP_001295163.1.86001 WP_001295163.1.86016 WP_001295163.1.8607 WP_001295163.1.86110 WP_001295163.1.86149 WP_001295163.1.86161 WP_001295163.1.86189 WP_001295163.1.8621 WP_001295163.1.86210 WP_001295163.1.86228 WP_001295163.1.86276 WP_001295163.1.86355 WP_001295163.1.86364 WP_001295163.1.86376 WP_001295163.1.86412 WP_001295163.1.86452 WP_001295163.1.86461 WP_001295163.1.86475 WP_001295163.1.86483 WP_001295163.1.86492 WP_001295163.1.86609 WP_001295163.1.86691 WP_001295163.1.86707 WP_001295163.1.86760 WP_001295163.1.86787 WP_001295163.1.86848 WP_001295163.1.86956 WP_001295163.1.86959 WP_001295163.1.86997 WP_001295163.1.8711 WP_001295163.1.87199 WP_001295163.1.87249 WP_001295163.1.87310 WP_001295163.1.87358 WP_001295163.1.87389 WP_001295163.1.87400 WP_001295163.1.87410 WP_001295163.1.87557 WP_001295163.1.87563 WP_001295163.1.87574 WP_001295163.1.87607 WP_001295163.1.87610 WP_001295163.1.87655 WP_001295163.1.87721 WP_001295163.1.87726 WP_001295163.1.87788 WP_001295163.1.87834 WP_001295163.1.87857 WP_001295163.1.87914 WP_001295163.1.87919 WP_001295163.1.87976 WP_001295163.1.87989 WP_001295163.1.88017 WP_001295163.1.88020 WP_001295163.1.88088 WP_001295163.1.88110 WP_001295163.1.88285 WP_001295163.1.88301 WP_001295163.1.88304 WP_001295163.1.88376 WP_001295163.1.88434 WP_001295163.1.88603 WP_001295163.1.88607 WP_001295163.1.88667 WP_001295163.1.88709 WP_001295163.1.88710 WP_001295163.1.88711 WP_001295163.1.88729 WP_001295163.1.88735 WP_001295163.1.88757 WP_001295163.1.8879 WP_001295163.1.88834 WP_001295163.1.88961 WP_001295163.1.89090 WP_001295163.1.89099 WP_001295163.1.89200 WP_001295163.1.8928 WP_001295163.1.89305 WP_001295163.1.894 WP_001295163.1.89416 WP_001295163.1.89432 WP_001295163.1.8945 WP_001295163.1.89458 WP_001295163.1.89468 WP_001295163.1.89471 WP_001295163.1.89630 WP_001295163.1.89674 WP_001295163.1.89679 WP_001295163.1.89768 WP_001295163.1.89788 WP_001295163.1.8985 WP_001295163.1.89899 WP_001295163.1.89920 WP_001295163.1.89923 WP_001295163.1.89927 WP_001295163.1.89977 WP_001295163.1.90017 WP_001295163.1.90078 WP_001295163.1.9009 WP_001295163.1.90128 WP_001295163.1.90168 WP_001295163.1.90205 WP_001295163.1.90256 WP_001295163.1.90314 WP_001295163.1.90358 WP_001295163.1.90511 WP_001295163.1.90520 WP_001295163.1.90536 WP_001295163.1.90547 WP_001295163.1.9059 WP_001295163.1.90626 WP_001295163.1.90703 WP_001295163.1.90706 WP_001295163.1.90799 WP_001295163.1.90864 WP_001295163.1.90865 WP_001295163.1.90873 WP_001295163.1.90924 WP_001295163.1.90951 WP_001295163.1.91 WP_001295163.1.91018 WP_001295163.1.91121 WP_001295163.1.91170 WP_001295163.1.91277 WP_001295163.1.91290 WP_001295163.1.91340 WP_001295163.1.91341 WP_001295163.1.91397 WP_001295163.1.91414 WP_001295163.1.91445 WP_001295163.1.91462 WP_001295163.1.915 WP_001295163.1.91551 WP_001295163.1.91565 WP_001295163.1.91596 WP_001295163.1.91640 WP_001295163.1.91643 WP_001295163.1.91685 WP_001295163.1.9169 WP_001295163.1.91739 WP_001295163.1.91777 WP_001295163.1.91850 WP_001295163.1.91863 WP_001295163.1.91879 WP_001295163.1.91959 WP_001295163.1.92019 WP_001295163.1.92048 WP_001295163.1.92114 WP_001295163.1.92123 WP_001295163.1.9215 WP_001295163.1.92161 WP_001295163.1.92180 WP_001295163.1.92215 WP_001295163.1.92323 WP_001295163.1.92361 WP_001295163.1.92496 WP_001295163.1.92532 WP_001295163.1.92568 WP_001295163.1.92614 WP_001295163.1.92615 WP_001295163.1.9264 WP_001295163.1.92693 WP_001295163.1.92708 WP_001295163.1.92742 WP_001295163.1.92845 WP_001295163.1.92865 WP_001295163.1.92943 WP_001295163.1.92953 WP_001295163.1.92989 WP_001295163.1.93005 WP_001295163.1.93016 WP_001295163.1.93019 WP_001295163.1.93023 WP_001295163.1.93048 WP_001295163.1.93054 WP_001295163.1.93072 WP_001295163.1.93100 WP_001295163.1.93175 WP_001295163.1.93276 WP_001295163.1.93309 WP_001295163.1.93312 WP_001295163.1.93379 WP_001295163.1.93605 WP_001295163.1.93626 WP_001295163.1.93629 WP_001295163.1.93634 WP_001295163.1.93637 WP_001295163.1.93652 WP_001295163.1.93673 WP_001295163.1.93743 WP_001295163.1.93755 WP_001295163.1.93877 WP_001295163.1.93911 WP_001295163.1.93918 WP_001295163.1.93951 WP_001295163.1.93971 WP_001295163.1.94011 WP_001295163.1.94025 WP_001295163.1.94057 WP_001295163.1.94156 WP_001295163.1.94176 WP_001295163.1.94187 WP_001295163.1.94190 WP_001295163.1.94232 WP_001295163.1.94271 WP_001295163.1.94317 WP_001295163.1.94445 WP_001295163.1.94542 WP_001295163.1.94548 WP_001295163.1.9457 WP_001295163.1.94578 WP_001295163.1.94626 WP_001295163.1.94692 WP_001295163.1.94695 WP_001295163.1.94738 WP_001295163.1.94754 WP_001295163.1.94764 WP_001295163.1.948 WP_001295163.1.94808 WP_001295163.1.94822 WP_001295163.1.9489 WP_001295163.1.94898 WP_001295163.1.94938 WP_001295163.1.94949 WP_001295163.1.94993 WP_001295163.1.95037 WP_001295163.1.95161 WP_001295163.1.95198 WP_001295163.1.95243 WP_001295163.1.95254 WP_001295163.1.95332 WP_001295163.1.95381 WP_001295163.1.95395 WP_001295163.1.95438 WP_001295163.1.95595 WP_001295163.1.95611 WP_001295163.1.95712 WP_001295163.1.95771 WP_001295163.1.95800 WP_001295163.1.95801 WP_001295163.1.95824 WP_001295163.1.95827 WP_001295163.1.95849 WP_001295163.1.95865 WP_001295163.1.95919 WP_001295163.1.95931 WP_001295163.1.95932 WP_001295163.1.960 WP_001295163.1.96053 WP_001295163.1.96066 WP_001295163.1.96114 WP_001295163.1.96128 WP_001295163.1.96177 WP_001295163.1.96215 WP_001295163.1.96222 WP_001295163.1.96281 WP_001295163.1.96290 WP_001295163.1.96299 WP_001295163.1.96303 WP_001295163.1.9631 WP_001295163.1.96339 WP_001295163.1.96341 WP_001295163.1.96394 WP_001295163.1.96417 WP_001295163.1.96479 WP_001295163.1.965 WP_001295163.1.9657 WP_001295163.1.96608 WP_001295163.1.96609 WP_001295163.1.9661 WP_001295163.1.96659 WP_001295163.1.96680 WP_001295163.1.96743 WP_001295163.1.96769 WP_001295163.1.96817 WP_001295163.1.9690 WP_001295163.1.9691 WP_001295163.1.96932 WP_001295163.1.96936 WP_001295163.1.96944 WP_001295163.1.96984 WP_001295163.1.97011 WP_001295163.1.97027 WP_001295163.1.97049 WP_001295163.1.97119 WP_001295163.1.97123 WP_001295163.1.97200 WP_001295163.1.97238 WP_001295163.1.97248 WP_001295163.1.97360 WP_001295163.1.97418 WP_001295163.1.97439 WP_001295163.1.9747 WP_001295163.1.97538 WP_001295163.1.97560 WP_001295163.1.97667 WP_001295163.1.97677 WP_001295163.1.97705 WP_001295163.1.97815 WP_001295163.1.97825 WP_001295163.1.97930 WP_001295163.1.97937 WP_001295163.1.97982 WP_001295163.1.98012 WP_001295163.1.98115 WP_001295163.1.98220 WP_001295163.1.98235 WP_001295163.1.98241 WP_001295163.1.98244 WP_001295163.1.98294 WP_001295163.1.98323 WP_001295163.1.98355 WP_001295163.1.98424 WP_001295163.1.9844 WP_001295163.1.98442 WP_001295163.1.98451 WP_001295163.1.98578 WP_001295163.1.9858 WP_001295163.1.98614 WP_001295163.1.98628 WP_001295163.1.9864 WP_001295163.1.98654 WP_001295163.1.98665 WP_001295163.1.98702 WP_001295163.1.98776 WP_001295163.1.99046 WP_001295163.1.99209 WP_001295163.1.99246 WP_001295163.1.99265 WP_001295163.1.99292 WP_001295163.1.99304 WP_001295163.1.99310 WP_001295163.1.99319 WP_001295163.1.99334 WP_001295163.1.99392 WP_001295163.1.99400 WP_001295163.1.99446 WP_001295163.1.99453 WP_001295163.1.99475 WP_001295163.1.99511 WP_001295163.1.99534 WP_001295163.1.99562 WP_001295163.1.99592 WP_001295163.1.99603 WP_001295163.1.99666 WP_001295163.1.99804 WP_001295163.1.99929 YP_006777172.1.12065

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]