SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|253771969|ref|YP_003034800.1| from Escherichia coli 'BL21-Gold(DE3)pLysS AG'

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|253771969|ref|YP_003034800.1|
Domain Number 1 Region: 14-325
Classification Level Classification E-value
Superfamily SIS domain 4.45e-68
Family mono-SIS domain 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|253771969|ref|YP_003034800.1|
Sequence length 328
Comment D-arabinose 5-phosphate isomerase [Escherichia coli 'BL21-Gold(DE3)pLysS AG']
Sequence
MSHVELQPGFDFQQAGKEVLAIERECLAELDQYINQNFTLACEKMFWCKGKVVVMGMGKS
GHIGRKMAATFASTGTPSFFVHPGEAAHGDLGMVTPQDVVIAISNSGESSEITALIPVLK
RLHVPLICITGRPESSMARAADVHLCVKVAKEACPLGLAPTSSTTATLVMGDALAVALLK
ARGFTAEDFALSHPGGALGRKLLLRVNDIMHTGDEIPHVKKTASLRDALLEVTRKNLGMT
VICDDNMMIEGIFTDGDLRRVFDMGVDVRQLSIADVMTPGGIRVRPGILAVEALNLMQSR
HITSVMVADGDHLLGVLHMHDLLRAGVV
Download sequence
Identical sequences A0A023Z373 A0A025CGL0 A0A026V1T4 A0A027U2X5 A0A028AJ19 A0A028ECH6 A0A029HK72 A0A029IK74 A0A064TF22 A0A069XR51 A0A070FDB0 A0A070T792 A0A070V9S5 A0A073FRI5 A0A074HT09 A0A080FT70 A0A0A0FHV9 A0A0A8UKD3 A0A0E0U3P2 A0A0E0VBG7 A0A0E0XU14 A0A0E1M1Y7 A0A0E1T064 A0A0E2L2U0 A0A0E2UA19 A0A0G3KAG6 A0A0H2Z396 A0A0H3EM40 A0A0H3MUX1 A0A0I1KE12 A0A0M9J562 A0A125WYD4 A0A140N7X0 A0A142H766 A0A170NR62 A0A1E2VPZ5 A0A1L5KLQ0 A0A1S6TH52 A0A1X3I3L0 A0A1X3IHS3 A0A1X3IY74 A0A1X3JCD0 A0A1X3K6L3 A0A1X3KYM6 A0A1X3LED0 A0A1X3LT03 A0A222QS17 A0A237FJZ6 A0A2A2XT71 A0A2D0P295 A0A2H1BNK9 A7ZS96 B1LGG3 B2U1Y0 B6I1S0 B7LHR0 B7MBW6 B7N0J0 B7UJT7 C3SSA7 C8UGF5 D0VEY0 D3QSR7 D6I1H7 D6IEA9 D6JF70 D7XN54 D7ZEQ0 D8A8Z0 D8EB06 E0J2P7 E1ILF2 E1JEE1 E3PKP5 E3XTA8 E6BFQ3 E7T9E2 E9TGR8 E9YUU8 F4SNS4 F4TJP0 F4V6T7 F4VJK0 G0F2J4 H4IFY8 H4IXL8 H4JDI8 H4KMH4 H4LHP9 H4UPQ2 I0VVD1 I2RDA9 I2SW23 I2UGX4 I2W8C2 I2X132 I2X6G4 I4T361 I6DPR0 J7R677 K0X600 K4UYA7 K4XKR8 L2VI38 L2X9R0 L3C1Z2 L3QDD9 L4J0L5 L4V2Z8 M9H3X3 P45395 Q31W74 Q3YX44 S0VS01 S0XJB3 S0YQC3 S1EAW7 S1I7E9 S1J250 S1PQ29 T5UJU6 T5ZT84 T6H7F3 T6LHU2 T9A6K6 T9CL62 T9S498 U9XUV3 U9XVK1 V0ALG6 V0SYS5 V0VQE6 V0X7I4 V0ZIN3 V2RVC6 V2T7H1 V6FY55 V8FP30 V8KME2 W1ASE7 W1EXM8 W1X3V4
gi|238902299|ref|YP_002928095.1| gi|471334757|ref|YP_007558234.1| gi|556553102|ref|YP_008723571.1| gi|387622859|ref|YP_006130487.1| gi|253771969|ref|YP_003034800.1| gi|387508601|ref|YP_006160857.1| gi|110643438|ref|YP_671168.1| gi|170018553|ref|YP_001723507.1| gi|386601223|ref|YP_006102729.1| gi|82545565|ref|YP_409512.1| gi|209920672|ref|YP_002294756.1| gi|386711104|ref|YP_006174825.1| gi|387831082|ref|YP_003351019.1| gi|383180377|ref|YP_005458382.1| gi|157158811|ref|YP_001464675.1| gi|157162681|ref|YP_001459999.1| gi|170082731|ref|YP_001732051.1| gi|187731792|ref|YP_001881888.1| gi|378711348|ref|YP_005276241.1| gi|386711104|ref|YP_006174825.1| gi|218701966|ref|YP_002409595.1| gi|410480733|ref|YP_006768279.1| gi|251786467|ref|YP_003000771.1| gi|260869948|ref|YP_003236350.1| gi|218560267|ref|YP_002393180.1| gi|254163139|ref|YP_003046247.1| 300268.SBO_3185 300269.SSON_3345 316385.ECDH10B_3371 316407.kdsD 331111.EcE24377A_3685 331112.EcHS_A3390 344609.SbBS512_E3573 362663.ECP_3285 405955.APECO1_3238 409438.ECSE_3481 413997.ECB_03062 439855.EcSMS35_3493 469008.ECBD_0545 481805.EcolC_0503 511145.b3197 573235.ECO26_4301 574521.E2348C_3476 585034.ECIAI1_3345 585035.ECS88_3580 585055.EC55989_3615 585057.ECIAI39_3692 585396.ECO111_4022 585397.ECED1_3855 595496.BWG_2899 gi|170679857|ref|YP_001745469.1| gi|407480172|ref|YP_006777321.1| gi|387618493|ref|YP_006121515.1| gi|222157909|ref|YP_002558048.1| gi|218691487|ref|YP_002399699.1| gi|386602720|ref|YP_006109020.1| gi|386615985|ref|YP_006135651.1| gi|215488513|ref|YP_002330944.1| gi|388479190|ref|YP_491382.1| NP_417664.1.90541 WP_001295557.1.1000 WP_001295557.1.100014 WP_001295557.1.100044 WP_001295557.1.100052 WP_001295557.1.100063 WP_001295557.1.100066 WP_001295557.1.100085 WP_001295557.1.100111 WP_001295557.1.100116 WP_001295557.1.100135 WP_001295557.1.100138 WP_001295557.1.100151 WP_001295557.1.100159 WP_001295557.1.100185 WP_001295557.1.100220 WP_001295557.1.100227 WP_001295557.1.100251 WP_001295557.1.100281 WP_001295557.1.100304 WP_001295557.1.100315 WP_001295557.1.10034 WP_001295557.1.100346 WP_001295557.1.100389 WP_001295557.1.100425 WP_001295557.1.100441 WP_001295557.1.100444 WP_001295557.1.100447 WP_001295557.1.100448 WP_001295557.1.100451 WP_001295557.1.100474 WP_001295557.1.10048 WP_001295557.1.100487 WP_001295557.1.100496 WP_001295557.1.100499 WP_001295557.1.10051 WP_001295557.1.100543 WP_001295557.1.100571 WP_001295557.1.100573 WP_001295557.1.100614 WP_001295557.1.100667 WP_001295557.1.10067 WP_001295557.1.10068 WP_001295557.1.100685 WP_001295557.1.100688 WP_001295557.1.100689 WP_001295557.1.100718 WP_001295557.1.100725 WP_001295557.1.100735 WP_001295557.1.100738 WP_001295557.1.100752 WP_001295557.1.100753 WP_001295557.1.100758 WP_001295557.1.100778 WP_001295557.1.100796 WP_001295557.1.10080 WP_001295557.1.100803 WP_001295557.1.100824 WP_001295557.1.100836 WP_001295557.1.100851 WP_001295557.1.100852 WP_001295557.1.10086 WP_001295557.1.100867 WP_001295557.1.100868 WP_001295557.1.100898 WP_001295557.1.100916 WP_001295557.1.100928 WP_001295557.1.100933 WP_001295557.1.10094 WP_001295557.1.100950 WP_001295557.1.100959 WP_001295557.1.100966 WP_001295557.1.100990 WP_001295557.1.101033 WP_001295557.1.101052 WP_001295557.1.101087 WP_001295557.1.101096 WP_001295557.1.101102 WP_001295557.1.101110 WP_001295557.1.101121 WP_001295557.1.101148 WP_001295557.1.101152 WP_001295557.1.101157 WP_001295557.1.101158 WP_001295557.1.101175 WP_001295557.1.101186 WP_001295557.1.101214 WP_001295557.1.101216 WP_001295557.1.101255 WP_001295557.1.10126 WP_001295557.1.101282 WP_001295557.1.101289 WP_001295557.1.101293 WP_001295557.1.10131 WP_001295557.1.101313 WP_001295557.1.101359 WP_001295557.1.101387 WP_001295557.1.101399 WP_001295557.1.101423 WP_001295557.1.101429 WP_001295557.1.101430 WP_001295557.1.101436 WP_001295557.1.101439 WP_001295557.1.101445 WP_001295557.1.101468 WP_001295557.1.101486 WP_001295557.1.101518 WP_001295557.1.10154 WP_001295557.1.101583 WP_001295557.1.101594 WP_001295557.1.101630 WP_001295557.1.101651 WP_001295557.1.101653 WP_001295557.1.101654 WP_001295557.1.101668 WP_001295557.1.101686 WP_001295557.1.101694 WP_001295557.1.101727 WP_001295557.1.10173 WP_001295557.1.101737 WP_001295557.1.101747 WP_001295557.1.101769 WP_001295557.1.101777 WP_001295557.1.101786 WP_001295557.1.10181 WP_001295557.1.101822 WP_001295557.1.10184 WP_001295557.1.101840 WP_001295557.1.101845 WP_001295557.1.101855 WP_001295557.1.101865 WP_001295557.1.10188 WP_001295557.1.101887 WP_001295557.1.101889 WP_001295557.1.10190 WP_001295557.1.101900 WP_001295557.1.101908 WP_001295557.1.101913 WP_001295557.1.101926 WP_001295557.1.101932 WP_001295557.1.101937 WP_001295557.1.101940 WP_001295557.1.101942 WP_001295557.1.101947 WP_001295557.1.101948 WP_001295557.1.101952 WP_001295557.1.101962 WP_001295557.1.101964 WP_001295557.1.101969 WP_001295557.1.101977 WP_001295557.1.101987 WP_001295557.1.102021 WP_001295557.1.102036 WP_001295557.1.102069 WP_001295557.1.102093 WP_001295557.1.102104 WP_001295557.1.102122 WP_001295557.1.102144 WP_001295557.1.10222 WP_001295557.1.10233 WP_001295557.1.10235 WP_001295557.1.10252 WP_001295557.1.10304 WP_001295557.1.10326 WP_001295557.1.10329 WP_001295557.1.10348 WP_001295557.1.10352 WP_001295557.1.10381 WP_001295557.1.1040 WP_001295557.1.10400 WP_001295557.1.10417 WP_001295557.1.10461 WP_001295557.1.10491 WP_001295557.1.10492 WP_001295557.1.10496 WP_001295557.1.10508 WP_001295557.1.10524 WP_001295557.1.10525 WP_001295557.1.10538 WP_001295557.1.10569 WP_001295557.1.10573 WP_001295557.1.10576 WP_001295557.1.10579 WP_001295557.1.1058 WP_001295557.1.10605 WP_001295557.1.10607 WP_001295557.1.10628 WP_001295557.1.10651 WP_001295557.1.10673 WP_001295557.1.10697 WP_001295557.1.10705 WP_001295557.1.1071 WP_001295557.1.10715 WP_001295557.1.10729 WP_001295557.1.10744 WP_001295557.1.10748 WP_001295557.1.10763 WP_001295557.1.10771 WP_001295557.1.10787 WP_001295557.1.10798 WP_001295557.1.10809 WP_001295557.1.10814 WP_001295557.1.10824 WP_001295557.1.10833 WP_001295557.1.10842 WP_001295557.1.10849 WP_001295557.1.10862 WP_001295557.1.10922 WP_001295557.1.10940 WP_001295557.1.10988 WP_001295557.1.10989 WP_001295557.1.10994 WP_001295557.1.10995 WP_001295557.1.11006 WP_001295557.1.11047 WP_001295557.1.11052 WP_001295557.1.11057 WP_001295557.1.11068 WP_001295557.1.11071 WP_001295557.1.11091 WP_001295557.1.11113 WP_001295557.1.11118 WP_001295557.1.11121 WP_001295557.1.1113 WP_001295557.1.11133 WP_001295557.1.112 WP_001295557.1.11217 WP_001295557.1.1122 WP_001295557.1.11241 WP_001295557.1.11250 WP_001295557.1.11251 WP_001295557.1.11265 WP_001295557.1.11272 WP_001295557.1.11296 WP_001295557.1.11315 WP_001295557.1.11323 WP_001295557.1.11399 WP_001295557.1.11408 WP_001295557.1.11418 WP_001295557.1.11440 WP_001295557.1.11452 WP_001295557.1.11467 WP_001295557.1.11499 WP_001295557.1.11519 WP_001295557.1.11524 WP_001295557.1.11531 WP_001295557.1.11542 WP_001295557.1.11578 WP_001295557.1.11595 WP_001295557.1.11607 WP_001295557.1.11608 WP_001295557.1.11612 WP_001295557.1.11616 WP_001295557.1.11645 WP_001295557.1.11673 WP_001295557.1.11699 WP_001295557.1.11759 WP_001295557.1.1176 WP_001295557.1.11762 WP_001295557.1.11801 WP_001295557.1.11844 WP_001295557.1.1186 WP_001295557.1.11949 WP_001295557.1.11955 WP_001295557.1.11956 WP_001295557.1.1196 WP_001295557.1.11982 WP_001295557.1.11985 WP_001295557.1.12000 WP_001295557.1.12009 WP_001295557.1.12010 WP_001295557.1.12030 WP_001295557.1.12050 WP_001295557.1.12051 WP_001295557.1.12060 WP_001295557.1.12076 WP_001295557.1.12088 WP_001295557.1.12095 WP_001295557.1.12111 WP_001295557.1.12112 WP_001295557.1.1212 WP_001295557.1.12151 WP_001295557.1.12157 WP_001295557.1.12174 WP_001295557.1.1218 WP_001295557.1.12204 WP_001295557.1.12230 WP_001295557.1.12292 WP_001295557.1.12319 WP_001295557.1.12320 WP_001295557.1.12342 WP_001295557.1.12352 WP_001295557.1.12415 WP_001295557.1.1242 WP_001295557.1.12458 WP_001295557.1.12459 WP_001295557.1.12468 WP_001295557.1.12478 WP_001295557.1.12542 WP_001295557.1.12558 WP_001295557.1.12566 WP_001295557.1.12582 WP_001295557.1.12594 WP_001295557.1.12623 WP_001295557.1.12645 WP_001295557.1.12646 WP_001295557.1.12675 WP_001295557.1.12679 WP_001295557.1.12680 WP_001295557.1.12693 WP_001295557.1.127 WP_001295557.1.12709 WP_001295557.1.12717 WP_001295557.1.12743 WP_001295557.1.12749 WP_001295557.1.1275 WP_001295557.1.12756 WP_001295557.1.12761 WP_001295557.1.12762 WP_001295557.1.12763 WP_001295557.1.12766 WP_001295557.1.12775 WP_001295557.1.12781 WP_001295557.1.1280 WP_001295557.1.12830 WP_001295557.1.12831 WP_001295557.1.12876 WP_001295557.1.12893 WP_001295557.1.12911 WP_001295557.1.12914 WP_001295557.1.12915 WP_001295557.1.12917 WP_001295557.1.1295 WP_001295557.1.12956 WP_001295557.1.12976 WP_001295557.1.12979 WP_001295557.1.12987 WP_001295557.1.12991 WP_001295557.1.13002 WP_001295557.1.13015 WP_001295557.1.13031 WP_001295557.1.13074 WP_001295557.1.1308 WP_001295557.1.1312 WP_001295557.1.13136 WP_001295557.1.1314 WP_001295557.1.13144 WP_001295557.1.1315 WP_001295557.1.13162 WP_001295557.1.13176 WP_001295557.1.13181 WP_001295557.1.13205 WP_001295557.1.13222 WP_001295557.1.1323 WP_001295557.1.13239 WP_001295557.1.13252 WP_001295557.1.13271 WP_001295557.1.13278 WP_001295557.1.13281 WP_001295557.1.13290 WP_001295557.1.13301 WP_001295557.1.13333 WP_001295557.1.13346 WP_001295557.1.1335 WP_001295557.1.13383 WP_001295557.1.13393 WP_001295557.1.13409 WP_001295557.1.13411 WP_001295557.1.1343 WP_001295557.1.13437 WP_001295557.1.1345 WP_001295557.1.13451 WP_001295557.1.13469 WP_001295557.1.13473 WP_001295557.1.13492 WP_001295557.1.13495 WP_001295557.1.13525 WP_001295557.1.13566 WP_001295557.1.13585 WP_001295557.1.13589 WP_001295557.1.13601 WP_001295557.1.13608 WP_001295557.1.13618 WP_001295557.1.13624 WP_001295557.1.13644 WP_001295557.1.13656 WP_001295557.1.13662 WP_001295557.1.13664 WP_001295557.1.13672 WP_001295557.1.13740 WP_001295557.1.13791 WP_001295557.1.13798 WP_001295557.1.13824 WP_001295557.1.13891 WP_001295557.1.13924 WP_001295557.1.13934 WP_001295557.1.13944 WP_001295557.1.13949 WP_001295557.1.13974 WP_001295557.1.13981 WP_001295557.1.14023 WP_001295557.1.14030 WP_001295557.1.14058 WP_001295557.1.14062 WP_001295557.1.14070 WP_001295557.1.14094 WP_001295557.1.14127 WP_001295557.1.14129 WP_001295557.1.14144 WP_001295557.1.14154 WP_001295557.1.14164 WP_001295557.1.1419 WP_001295557.1.14199 WP_001295557.1.142 WP_001295557.1.14253 WP_001295557.1.14277 WP_001295557.1.14292 WP_001295557.1.14299 WP_001295557.1.14304 WP_001295557.1.14322 WP_001295557.1.14331 WP_001295557.1.14346 WP_001295557.1.1438 WP_001295557.1.14389 WP_001295557.1.1439 WP_001295557.1.14398 WP_001295557.1.14432 WP_001295557.1.14445 WP_001295557.1.14451 WP_001295557.1.14468 WP_001295557.1.14493 WP_001295557.1.14499 WP_001295557.1.14501 WP_001295557.1.14508 WP_001295557.1.14509 WP_001295557.1.14529 WP_001295557.1.14536 WP_001295557.1.14538 WP_001295557.1.14581 WP_001295557.1.14582 WP_001295557.1.14600 WP_001295557.1.14601 WP_001295557.1.14605 WP_001295557.1.14607 WP_001295557.1.1461 WP_001295557.1.14616 WP_001295557.1.14648 WP_001295557.1.14661 WP_001295557.1.14678 WP_001295557.1.14687 WP_001295557.1.14693 WP_001295557.1.1470 WP_001295557.1.14711 WP_001295557.1.14712 WP_001295557.1.14749 WP_001295557.1.14811 WP_001295557.1.14833 WP_001295557.1.1486 WP_001295557.1.14861 WP_001295557.1.14871 WP_001295557.1.14879 WP_001295557.1.14914 WP_001295557.1.14934 WP_001295557.1.14935 WP_001295557.1.14946 WP_001295557.1.14956 WP_001295557.1.14958 WP_001295557.1.14963 WP_001295557.1.14965 WP_001295557.1.14977 WP_001295557.1.14993 WP_001295557.1.15007 WP_001295557.1.15020 WP_001295557.1.15041 WP_001295557.1.1508 WP_001295557.1.1510 WP_001295557.1.15117 WP_001295557.1.1512 WP_001295557.1.15121 WP_001295557.1.15138 WP_001295557.1.15148 WP_001295557.1.15177 WP_001295557.1.15191 WP_001295557.1.15193 WP_001295557.1.15221 WP_001295557.1.1524 WP_001295557.1.15245 WP_001295557.1.15252 WP_001295557.1.15259 WP_001295557.1.15270 WP_001295557.1.15274 WP_001295557.1.15277 WP_001295557.1.15282 WP_001295557.1.15287 WP_001295557.1.15290 WP_001295557.1.153 WP_001295557.1.15332 WP_001295557.1.15335 WP_001295557.1.15347 WP_001295557.1.15377 WP_001295557.1.15416 WP_001295557.1.15420 WP_001295557.1.1543 WP_001295557.1.15444 WP_001295557.1.15453 WP_001295557.1.15464 WP_001295557.1.15469 WP_001295557.1.15496 WP_001295557.1.1550 WP_001295557.1.15521 WP_001295557.1.15528 WP_001295557.1.15565 WP_001295557.1.15576 WP_001295557.1.15583 WP_001295557.1.15593 WP_001295557.1.15600 WP_001295557.1.1561 WP_001295557.1.15624 WP_001295557.1.15645 WP_001295557.1.15654 WP_001295557.1.15707 WP_001295557.1.15731 WP_001295557.1.15740 WP_001295557.1.15747 WP_001295557.1.15752 WP_001295557.1.15762 WP_001295557.1.15767 WP_001295557.1.15768 WP_001295557.1.15771 WP_001295557.1.15791 WP_001295557.1.1580 WP_001295557.1.15809 WP_001295557.1.1582 WP_001295557.1.15855 WP_001295557.1.15857 WP_001295557.1.15863 WP_001295557.1.15869 WP_001295557.1.1588 WP_001295557.1.15894 WP_001295557.1.15906 WP_001295557.1.15916 WP_001295557.1.15945 WP_001295557.1.15949 WP_001295557.1.15984 WP_001295557.1.15990 WP_001295557.1.16010 WP_001295557.1.16014 WP_001295557.1.16015 WP_001295557.1.16034 WP_001295557.1.1604 WP_001295557.1.16042 WP_001295557.1.16067 WP_001295557.1.16086 WP_001295557.1.16087 WP_001295557.1.1609 WP_001295557.1.16102 WP_001295557.1.16111 WP_001295557.1.16117 WP_001295557.1.16131 WP_001295557.1.16154 WP_001295557.1.16171 WP_001295557.1.16175 WP_001295557.1.16179 WP_001295557.1.16183 WP_001295557.1.16188 WP_001295557.1.16194 WP_001295557.1.1622 WP_001295557.1.16270 WP_001295557.1.16294 WP_001295557.1.163 WP_001295557.1.16303 WP_001295557.1.16322 WP_001295557.1.1634 WP_001295557.1.16387 WP_001295557.1.16388 WP_001295557.1.16396 WP_001295557.1.1640 WP_001295557.1.16435 WP_001295557.1.16482 WP_001295557.1.16500 WP_001295557.1.16517 WP_001295557.1.16532 WP_001295557.1.16539 WP_001295557.1.16541 WP_001295557.1.1655 WP_001295557.1.16577 WP_001295557.1.16592 WP_001295557.1.16604 WP_001295557.1.16608 WP_001295557.1.16612 WP_001295557.1.16640 WP_001295557.1.16648 WP_001295557.1.16667 WP_001295557.1.16669 WP_001295557.1.16682 WP_001295557.1.16700 WP_001295557.1.16715 WP_001295557.1.16721 WP_001295557.1.1673 WP_001295557.1.16745 WP_001295557.1.16752 WP_001295557.1.16766 WP_001295557.1.16780 WP_001295557.1.16798 WP_001295557.1.16799 WP_001295557.1.16805 WP_001295557.1.16807 WP_001295557.1.16818 WP_001295557.1.16843 WP_001295557.1.16862 WP_001295557.1.16894 WP_001295557.1.16927 WP_001295557.1.16970 WP_001295557.1.16979 WP_001295557.1.16992 WP_001295557.1.17014 WP_001295557.1.17017 WP_001295557.1.17018 WP_001295557.1.17028 WP_001295557.1.17042 WP_001295557.1.17061 WP_001295557.1.17084 WP_001295557.1.17085 WP_001295557.1.17087 WP_001295557.1.17089 WP_001295557.1.1710 WP_001295557.1.17101 WP_001295557.1.17102 WP_001295557.1.17109 WP_001295557.1.17114 WP_001295557.1.17119 WP_001295557.1.17123 WP_001295557.1.17150 WP_001295557.1.17153 WP_001295557.1.17172 WP_001295557.1.17182 WP_001295557.1.17186 WP_001295557.1.17205 WP_001295557.1.17206 WP_001295557.1.17216 WP_001295557.1.17230 WP_001295557.1.17241 WP_001295557.1.17242 WP_001295557.1.1726 WP_001295557.1.17267 WP_001295557.1.17282 WP_001295557.1.17290 WP_001295557.1.17297 WP_001295557.1.17300 WP_001295557.1.17301 WP_001295557.1.1731 WP_001295557.1.17333 WP_001295557.1.17356 WP_001295557.1.17360 WP_001295557.1.17373 WP_001295557.1.17386 WP_001295557.1.17387 WP_001295557.1.17389 WP_001295557.1.17392 WP_001295557.1.17403 WP_001295557.1.17410 WP_001295557.1.17432 WP_001295557.1.17441 WP_001295557.1.17461 WP_001295557.1.17464 WP_001295557.1.17496 WP_001295557.1.17534 WP_001295557.1.1755 WP_001295557.1.17550 WP_001295557.1.17570 WP_001295557.1.17577 WP_001295557.1.17584 WP_001295557.1.17595 WP_001295557.1.17623 WP_001295557.1.1763 WP_001295557.1.17637 WP_001295557.1.1766 WP_001295557.1.1769 WP_001295557.1.17701 WP_001295557.1.17734 WP_001295557.1.17757 WP_001295557.1.17765 WP_001295557.1.17766 WP_001295557.1.1778 WP_001295557.1.17802 WP_001295557.1.17829 WP_001295557.1.17831 WP_001295557.1.17836 WP_001295557.1.17889 WP_001295557.1.17920 WP_001295557.1.17925 WP_001295557.1.17937 WP_001295557.1.17952 WP_001295557.1.17961 WP_001295557.1.17963 WP_001295557.1.17984 WP_001295557.1.18000 WP_001295557.1.18006 WP_001295557.1.1802 WP_001295557.1.18024 WP_001295557.1.18050 WP_001295557.1.18064 WP_001295557.1.18094 WP_001295557.1.18112 WP_001295557.1.18118 WP_001295557.1.18121 WP_001295557.1.18133 WP_001295557.1.18134 WP_001295557.1.18164 WP_001295557.1.18175 WP_001295557.1.1821 WP_001295557.1.18225 WP_001295557.1.18226 WP_001295557.1.18229 WP_001295557.1.18275 WP_001295557.1.18311 WP_001295557.1.18337 WP_001295557.1.18338 WP_001295557.1.18348 WP_001295557.1.18354 WP_001295557.1.18381 WP_001295557.1.18383 WP_001295557.1.18394 WP_001295557.1.18402 WP_001295557.1.18410 WP_001295557.1.18420 WP_001295557.1.18436 WP_001295557.1.18438 WP_001295557.1.1844 WP_001295557.1.18458 WP_001295557.1.18461 WP_001295557.1.18472 WP_001295557.1.18482 WP_001295557.1.18511 WP_001295557.1.18519 WP_001295557.1.18530 WP_001295557.1.18550 WP_001295557.1.18556 WP_001295557.1.18581 WP_001295557.1.18583 WP_001295557.1.18588 WP_001295557.1.18617 WP_001295557.1.1862 WP_001295557.1.18628 WP_001295557.1.18649 WP_001295557.1.18650 WP_001295557.1.18651 WP_001295557.1.18655 WP_001295557.1.1866 WP_001295557.1.18666 WP_001295557.1.1867 WP_001295557.1.18675 WP_001295557.1.18699 WP_001295557.1.18714 WP_001295557.1.18725 WP_001295557.1.18726 WP_001295557.1.1873 WP_001295557.1.18794 WP_001295557.1.18801 WP_001295557.1.18802 WP_001295557.1.18806 WP_001295557.1.18828 WP_001295557.1.18858 WP_001295557.1.18861 WP_001295557.1.18874 WP_001295557.1.18876 WP_001295557.1.18899 WP_001295557.1.18929 WP_001295557.1.18934 WP_001295557.1.18936 WP_001295557.1.1896 WP_001295557.1.18962 WP_001295557.1.18966 WP_001295557.1.18983 WP_001295557.1.1903 WP_001295557.1.1906 WP_001295557.1.19075 WP_001295557.1.1909 WP_001295557.1.19090 WP_001295557.1.19100 WP_001295557.1.19113 WP_001295557.1.19114 WP_001295557.1.19122 WP_001295557.1.19129 WP_001295557.1.19135 WP_001295557.1.19146 WP_001295557.1.19147 WP_001295557.1.1915 WP_001295557.1.19150 WP_001295557.1.19153 WP_001295557.1.19194 WP_001295557.1.19205 WP_001295557.1.19206 WP_001295557.1.19245 WP_001295557.1.1925 WP_001295557.1.19277 WP_001295557.1.193 WP_001295557.1.19312 WP_001295557.1.19313 WP_001295557.1.19314 WP_001295557.1.19315 WP_001295557.1.19332 WP_001295557.1.19338 WP_001295557.1.19347 WP_001295557.1.19361 WP_001295557.1.19374 WP_001295557.1.19379 WP_001295557.1.19389 WP_001295557.1.19419 WP_001295557.1.19424 WP_001295557.1.19441 WP_001295557.1.19448 WP_001295557.1.19465 WP_001295557.1.19478 WP_001295557.1.19487 WP_001295557.1.19492 WP_001295557.1.19494 WP_001295557.1.19534 WP_001295557.1.19544 WP_001295557.1.19547 WP_001295557.1.19557 WP_001295557.1.19581 WP_001295557.1.19583 WP_001295557.1.19593 WP_001295557.1.19602 WP_001295557.1.1963 WP_001295557.1.19644 WP_001295557.1.19649 WP_001295557.1.19651 WP_001295557.1.19654 WP_001295557.1.19655 WP_001295557.1.19661 WP_001295557.1.19684 WP_001295557.1.19691 WP_001295557.1.19758 WP_001295557.1.19778 WP_001295557.1.19795 WP_001295557.1.1982 WP_001295557.1.19838 WP_001295557.1.19845 WP_001295557.1.19861 WP_001295557.1.1987 WP_001295557.1.19873 WP_001295557.1.19878 WP_001295557.1.19889 WP_001295557.1.19940 WP_001295557.1.19945 WP_001295557.1.19957 WP_001295557.1.19994 WP_001295557.1.20025 WP_001295557.1.20096 WP_001295557.1.20114 WP_001295557.1.20115 WP_001295557.1.20129 WP_001295557.1.20133 WP_001295557.1.20157 WP_001295557.1.20159 WP_001295557.1.20164 WP_001295557.1.20166 WP_001295557.1.20170 WP_001295557.1.20178 WP_001295557.1.20183 WP_001295557.1.20192 WP_001295557.1.20215 WP_001295557.1.2022 WP_001295557.1.20230 WP_001295557.1.20238 WP_001295557.1.20251 WP_001295557.1.20264 WP_001295557.1.2027 WP_001295557.1.20290 WP_001295557.1.20308 WP_001295557.1.20318 WP_001295557.1.20325 WP_001295557.1.20331 WP_001295557.1.20334 WP_001295557.1.20370 WP_001295557.1.20445 WP_001295557.1.20452 WP_001295557.1.20480 WP_001295557.1.20483 WP_001295557.1.20493 WP_001295557.1.20506 WP_001295557.1.20515 WP_001295557.1.20519 WP_001295557.1.20536 WP_001295557.1.20549 WP_001295557.1.20565 WP_001295557.1.20575 WP_001295557.1.20596 WP_001295557.1.20609 WP_001295557.1.2063 WP_001295557.1.20636 WP_001295557.1.20638 WP_001295557.1.20640 WP_001295557.1.20662 WP_001295557.1.20668 WP_001295557.1.20691 WP_001295557.1.20709 WP_001295557.1.20724 WP_001295557.1.20730 WP_001295557.1.20737 WP_001295557.1.20741 WP_001295557.1.20761 WP_001295557.1.20765 WP_001295557.1.20784 WP_001295557.1.20785 WP_001295557.1.20803 WP_001295557.1.20813 WP_001295557.1.20818 WP_001295557.1.20824 WP_001295557.1.20831 WP_001295557.1.20841 WP_001295557.1.20848 WP_001295557.1.2089 WP_001295557.1.20907 WP_001295557.1.2093 WP_001295557.1.20933 WP_001295557.1.2094 WP_001295557.1.20943 WP_001295557.1.20958 WP_001295557.1.20982 WP_001295557.1.2100 WP_001295557.1.21017 WP_001295557.1.21020 WP_001295557.1.21022 WP_001295557.1.21024 WP_001295557.1.21033 WP_001295557.1.21041 WP_001295557.1.21057 WP_001295557.1.21059 WP_001295557.1.21104 WP_001295557.1.21122 WP_001295557.1.21129 WP_001295557.1.2113 WP_001295557.1.21131 WP_001295557.1.21137 WP_001295557.1.21152 WP_001295557.1.21171 WP_001295557.1.21197 WP_001295557.1.21251 WP_001295557.1.21266 WP_001295557.1.21277 WP_001295557.1.21305 WP_001295557.1.21320 WP_001295557.1.21336 WP_001295557.1.21378 WP_001295557.1.2142 WP_001295557.1.21441 WP_001295557.1.21450 WP_001295557.1.21455 WP_001295557.1.21470 WP_001295557.1.21526 WP_001295557.1.21537 WP_001295557.1.2156 WP_001295557.1.21573 WP_001295557.1.21578 WP_001295557.1.21596 WP_001295557.1.21628 WP_001295557.1.21634 WP_001295557.1.21637 WP_001295557.1.2164 WP_001295557.1.21652 WP_001295557.1.21656 WP_001295557.1.21661 WP_001295557.1.21667 WP_001295557.1.21673 WP_001295557.1.21696 WP_001295557.1.21714 WP_001295557.1.21727 WP_001295557.1.21729 WP_001295557.1.21732 WP_001295557.1.21733 WP_001295557.1.21756 WP_001295557.1.21758 WP_001295557.1.21762 WP_001295557.1.21771 WP_001295557.1.21811 WP_001295557.1.21823 WP_001295557.1.21887 WP_001295557.1.21895 WP_001295557.1.21899 WP_001295557.1.21915 WP_001295557.1.21945 WP_001295557.1.21986 WP_001295557.1.22042 WP_001295557.1.22060 WP_001295557.1.22113 WP_001295557.1.22138 WP_001295557.1.22161 WP_001295557.1.22189 WP_001295557.1.22195 WP_001295557.1.22203 WP_001295557.1.22204 WP_001295557.1.22268 WP_001295557.1.22269 WP_001295557.1.22272 WP_001295557.1.22280 WP_001295557.1.22291 WP_001295557.1.22295 WP_001295557.1.22314 WP_001295557.1.2232 WP_001295557.1.22325 WP_001295557.1.22350 WP_001295557.1.22359 WP_001295557.1.22363 WP_001295557.1.2242 WP_001295557.1.22431 WP_001295557.1.2245 WP_001295557.1.22450 WP_001295557.1.22464 WP_001295557.1.22470 WP_001295557.1.22494 WP_001295557.1.22501 WP_001295557.1.22508 WP_001295557.1.22543 WP_001295557.1.22544 WP_001295557.1.22549 WP_001295557.1.22571 WP_001295557.1.22572 WP_001295557.1.22574 WP_001295557.1.22576 WP_001295557.1.22579 WP_001295557.1.22599 WP_001295557.1.22602 WP_001295557.1.22631 WP_001295557.1.22632 WP_001295557.1.22641 WP_001295557.1.22649 WP_001295557.1.22662 WP_001295557.1.22669 WP_001295557.1.22685 WP_001295557.1.22690 WP_001295557.1.22691 WP_001295557.1.22756 WP_001295557.1.22757 WP_001295557.1.22759 WP_001295557.1.22765 WP_001295557.1.22777 WP_001295557.1.22783 WP_001295557.1.22809 WP_001295557.1.22824 WP_001295557.1.22827 WP_001295557.1.22830 WP_001295557.1.22846 WP_001295557.1.22868 WP_001295557.1.22875 WP_001295557.1.22878 WP_001295557.1.22885 WP_001295557.1.22908 WP_001295557.1.22917 WP_001295557.1.22939 WP_001295557.1.22961 WP_001295557.1.22990 WP_001295557.1.22993 WP_001295557.1.2300 WP_001295557.1.23005 WP_001295557.1.23021 WP_001295557.1.23026 WP_001295557.1.23035 WP_001295557.1.23044 WP_001295557.1.23045 WP_001295557.1.23057 WP_001295557.1.23062 WP_001295557.1.23078 WP_001295557.1.23081 WP_001295557.1.23090 WP_001295557.1.23092 WP_001295557.1.23105 WP_001295557.1.23109 WP_001295557.1.23120 WP_001295557.1.23135 WP_001295557.1.2322 WP_001295557.1.23230 WP_001295557.1.2325 WP_001295557.1.23257 WP_001295557.1.23270 WP_001295557.1.23290 WP_001295557.1.23293 WP_001295557.1.23299 WP_001295557.1.23330 WP_001295557.1.23351 WP_001295557.1.23352 WP_001295557.1.23355 WP_001295557.1.23376 WP_001295557.1.23378 WP_001295557.1.23383 WP_001295557.1.23386 WP_001295557.1.23388 WP_001295557.1.23393 WP_001295557.1.23435 WP_001295557.1.23443 WP_001295557.1.23456 WP_001295557.1.23463 WP_001295557.1.23486 WP_001295557.1.23487 WP_001295557.1.23511 WP_001295557.1.23520 WP_001295557.1.23522 WP_001295557.1.23527 WP_001295557.1.2353 WP_001295557.1.23549 WP_001295557.1.23554 WP_001295557.1.23561 WP_001295557.1.23563 WP_001295557.1.23575 WP_001295557.1.23584 WP_001295557.1.23593 WP_001295557.1.2362 WP_001295557.1.23625 WP_001295557.1.23660 WP_001295557.1.23676 WP_001295557.1.23686 WP_001295557.1.23693 WP_001295557.1.23711 WP_001295557.1.23724 WP_001295557.1.23729 WP_001295557.1.23741 WP_001295557.1.23754 WP_001295557.1.23765 WP_001295557.1.23795 WP_001295557.1.23812 WP_001295557.1.23840 WP_001295557.1.23855 WP_001295557.1.23869 WP_001295557.1.23881 WP_001295557.1.23886 WP_001295557.1.23890 WP_001295557.1.23898 WP_001295557.1.23914 WP_001295557.1.23915 WP_001295557.1.23931 WP_001295557.1.23945 WP_001295557.1.23950 WP_001295557.1.23953 WP_001295557.1.23960 WP_001295557.1.23962 WP_001295557.1.23971 WP_001295557.1.23985 WP_001295557.1.24 WP_001295557.1.24024 WP_001295557.1.24038 WP_001295557.1.24045 WP_001295557.1.24051 WP_001295557.1.24058 WP_001295557.1.24068 WP_001295557.1.24088 WP_001295557.1.24089 WP_001295557.1.24120 WP_001295557.1.24122 WP_001295557.1.24127 WP_001295557.1.24136 WP_001295557.1.24169 WP_001295557.1.2418 WP_001295557.1.24194 WP_001295557.1.24278 WP_001295557.1.2428 WP_001295557.1.24290 WP_001295557.1.2430 WP_001295557.1.24316 WP_001295557.1.2437 WP_001295557.1.24374 WP_001295557.1.24381 WP_001295557.1.24383 WP_001295557.1.24458 WP_001295557.1.24460 WP_001295557.1.24473 WP_001295557.1.24483 WP_001295557.1.24485 WP_001295557.1.2449 WP_001295557.1.24499 WP_001295557.1.24524 WP_001295557.1.24533 WP_001295557.1.24536 WP_001295557.1.2456 WP_001295557.1.24560 WP_001295557.1.24570 WP_001295557.1.24575 WP_001295557.1.24577 WP_001295557.1.24583 WP_001295557.1.24592 WP_001295557.1.24616 WP_001295557.1.24634 WP_001295557.1.24641 WP_001295557.1.24642 WP_001295557.1.24646 WP_001295557.1.2469 WP_001295557.1.24693 WP_001295557.1.24695 WP_001295557.1.24703 WP_001295557.1.24752 WP_001295557.1.24758 WP_001295557.1.24763 WP_001295557.1.24773 WP_001295557.1.24783 WP_001295557.1.2479 WP_001295557.1.24791 WP_001295557.1.24799 WP_001295557.1.24849 WP_001295557.1.24854 WP_001295557.1.24876 WP_001295557.1.24899 WP_001295557.1.24906 WP_001295557.1.24909 WP_001295557.1.24929 WP_001295557.1.24939 WP_001295557.1.24946 WP_001295557.1.24960 WP_001295557.1.24968 WP_001295557.1.24979 WP_001295557.1.24981 WP_001295557.1.24982 WP_001295557.1.24984 WP_001295557.1.25019 WP_001295557.1.2502 WP_001295557.1.25021 WP_001295557.1.25039 WP_001295557.1.2504 WP_001295557.1.25042 WP_001295557.1.25050 WP_001295557.1.25060 WP_001295557.1.25079 WP_001295557.1.25085 WP_001295557.1.25086 WP_001295557.1.25087 WP_001295557.1.2512 WP_001295557.1.25126 WP_001295557.1.25141 WP_001295557.1.25174 WP_001295557.1.25183 WP_001295557.1.25193 WP_001295557.1.25203 WP_001295557.1.25248 WP_001295557.1.25270 WP_001295557.1.25272 WP_001295557.1.25289 WP_001295557.1.2531 WP_001295557.1.25312 WP_001295557.1.25324 WP_001295557.1.25346 WP_001295557.1.2537 WP_001295557.1.25372 WP_001295557.1.25378 WP_001295557.1.25380 WP_001295557.1.254 WP_001295557.1.2540 WP_001295557.1.25403 WP_001295557.1.25420 WP_001295557.1.2543 WP_001295557.1.25446 WP_001295557.1.25480 WP_001295557.1.255 WP_001295557.1.25517 WP_001295557.1.25525 WP_001295557.1.2558 WP_001295557.1.25592 WP_001295557.1.25598 WP_001295557.1.25602 WP_001295557.1.25613 WP_001295557.1.25631 WP_001295557.1.25643 WP_001295557.1.25652 WP_001295557.1.2567 WP_001295557.1.25681 WP_001295557.1.25701 WP_001295557.1.25712 WP_001295557.1.25713 WP_001295557.1.25717 WP_001295557.1.25718 WP_001295557.1.25724 WP_001295557.1.25726 WP_001295557.1.25750 WP_001295557.1.25753 WP_001295557.1.25755 WP_001295557.1.25832 WP_001295557.1.25843 WP_001295557.1.25855 WP_001295557.1.25869 WP_001295557.1.25873 WP_001295557.1.2588 WP_001295557.1.25886 WP_001295557.1.2589 WP_001295557.1.25895 WP_001295557.1.25915 WP_001295557.1.25945 WP_001295557.1.2597 WP_001295557.1.25996 WP_001295557.1.26040 WP_001295557.1.26048 WP_001295557.1.26055 WP_001295557.1.2606 WP_001295557.1.26076 WP_001295557.1.26092 WP_001295557.1.26100 WP_001295557.1.2612 WP_001295557.1.26125 WP_001295557.1.26130 WP_001295557.1.26135 WP_001295557.1.26150 WP_001295557.1.26161 WP_001295557.1.26186 WP_001295557.1.26189 WP_001295557.1.26191 WP_001295557.1.26196 WP_001295557.1.26259 WP_001295557.1.26264 WP_001295557.1.26270 WP_001295557.1.26304 WP_001295557.1.26325 WP_001295557.1.26331 WP_001295557.1.2637 WP_001295557.1.26379 WP_001295557.1.26391 WP_001295557.1.26401 WP_001295557.1.26419 WP_001295557.1.2642 WP_001295557.1.26438 WP_001295557.1.26467 WP_001295557.1.26479 WP_001295557.1.26480 WP_001295557.1.26569 WP_001295557.1.26570 WP_001295557.1.26574 WP_001295557.1.26575 WP_001295557.1.26588 WP_001295557.1.26590 WP_001295557.1.26598 WP_001295557.1.26609 WP_001295557.1.26613 WP_001295557.1.26627 WP_001295557.1.26644 WP_001295557.1.2665 WP_001295557.1.26658 WP_001295557.1.26659 WP_001295557.1.26660 WP_001295557.1.26683 WP_001295557.1.26688 WP_001295557.1.26716 WP_001295557.1.26720 WP_001295557.1.26766 WP_001295557.1.26782 WP_001295557.1.26861 WP_001295557.1.2688 WP_001295557.1.26912 WP_001295557.1.26932 WP_001295557.1.26941 WP_001295557.1.26943 WP_001295557.1.2695 WP_001295557.1.26950 WP_001295557.1.26987 WP_001295557.1.26995 WP_001295557.1.27019 WP_001295557.1.27043 WP_001295557.1.27057 WP_001295557.1.27060 WP_001295557.1.27091 WP_001295557.1.27098 WP_001295557.1.27101 WP_001295557.1.27105 WP_001295557.1.2712 WP_001295557.1.27134 WP_001295557.1.27141 WP_001295557.1.27148 WP_001295557.1.27175 WP_001295557.1.27188 WP_001295557.1.27214 WP_001295557.1.27260 WP_001295557.1.27280 WP_001295557.1.27283 WP_001295557.1.27287 WP_001295557.1.27292 WP_001295557.1.2731 WP_001295557.1.27310 WP_001295557.1.27330 WP_001295557.1.27367 WP_001295557.1.27373 WP_001295557.1.27401 WP_001295557.1.27424 WP_001295557.1.27426 WP_001295557.1.2745 WP_001295557.1.27451 WP_001295557.1.27518 WP_001295557.1.27520 WP_001295557.1.27524 WP_001295557.1.2755 WP_001295557.1.27560 WP_001295557.1.27580 WP_001295557.1.27611 WP_001295557.1.27618 WP_001295557.1.27683 WP_001295557.1.27693 WP_001295557.1.27698 WP_001295557.1.27741 WP_001295557.1.27742 WP_001295557.1.27749 WP_001295557.1.27758 WP_001295557.1.27774 WP_001295557.1.27786 WP_001295557.1.27797 WP_001295557.1.2782 WP_001295557.1.27846 WP_001295557.1.27856 WP_001295557.1.27861 WP_001295557.1.27876 WP_001295557.1.27879 WP_001295557.1.27897 WP_001295557.1.27913 WP_001295557.1.27923 WP_001295557.1.27932 WP_001295557.1.2794 WP_001295557.1.27971 WP_001295557.1.27998 WP_001295557.1.28008 WP_001295557.1.28026 WP_001295557.1.28027 WP_001295557.1.28046 WP_001295557.1.28051 WP_001295557.1.28109 WP_001295557.1.2811 WP_001295557.1.28110 WP_001295557.1.28128 WP_001295557.1.28145 WP_001295557.1.28156 WP_001295557.1.28167 WP_001295557.1.28168 WP_001295557.1.28184 WP_001295557.1.28199 WP_001295557.1.28250 WP_001295557.1.2826 WP_001295557.1.28268 WP_001295557.1.28271 WP_001295557.1.28305 WP_001295557.1.28314 WP_001295557.1.28318 WP_001295557.1.28322 WP_001295557.1.28349 WP_001295557.1.28371 WP_001295557.1.2838 WP_001295557.1.28401 WP_001295557.1.28414 WP_001295557.1.28433 WP_001295557.1.28440 WP_001295557.1.28461 WP_001295557.1.28476 WP_001295557.1.28480 WP_001295557.1.28496 WP_001295557.1.285 WP_001295557.1.28500 WP_001295557.1.28509 WP_001295557.1.28523 WP_001295557.1.28536 WP_001295557.1.28540 WP_001295557.1.28544 WP_001295557.1.28554 WP_001295557.1.28568 WP_001295557.1.2866 WP_001295557.1.28662 WP_001295557.1.28683 WP_001295557.1.28697 WP_001295557.1.28711 WP_001295557.1.28732 WP_001295557.1.28736 WP_001295557.1.28742 WP_001295557.1.28760 WP_001295557.1.28762 WP_001295557.1.28769 WP_001295557.1.28791 WP_001295557.1.28809 WP_001295557.1.2881 WP_001295557.1.28829 WP_001295557.1.28835 WP_001295557.1.28842 WP_001295557.1.28863 WP_001295557.1.28919 WP_001295557.1.28950 WP_001295557.1.28953 WP_001295557.1.28982 WP_001295557.1.28994 WP_001295557.1.290 WP_001295557.1.29001 WP_001295557.1.29013 WP_001295557.1.29016 WP_001295557.1.29049 WP_001295557.1.29055 WP_001295557.1.29061 WP_001295557.1.29079 WP_001295557.1.29082 WP_001295557.1.29100 WP_001295557.1.29118 WP_001295557.1.29125 WP_001295557.1.29128 WP_001295557.1.29146 WP_001295557.1.29150 WP_001295557.1.29164 WP_001295557.1.29176 WP_001295557.1.29194 WP_001295557.1.29197 WP_001295557.1.29202 WP_001295557.1.29206 WP_001295557.1.29221 WP_001295557.1.29230 WP_001295557.1.29239 WP_001295557.1.29252 WP_001295557.1.2926 WP_001295557.1.29341 WP_001295557.1.29377 WP_001295557.1.29394 WP_001295557.1.2942 WP_001295557.1.29429 WP_001295557.1.29443 WP_001295557.1.2945 WP_001295557.1.29486 WP_001295557.1.29495 WP_001295557.1.29497 WP_001295557.1.29503 WP_001295557.1.29504 WP_001295557.1.29513 WP_001295557.1.2952 WP_001295557.1.29523 WP_001295557.1.2954 WP_001295557.1.29556 WP_001295557.1.29590 WP_001295557.1.29603 WP_001295557.1.29643 WP_001295557.1.29662 WP_001295557.1.29669 WP_001295557.1.29683 WP_001295557.1.29699 WP_001295557.1.29715 WP_001295557.1.29724 WP_001295557.1.29740 WP_001295557.1.29746 WP_001295557.1.29752 WP_001295557.1.29798 WP_001295557.1.29812 WP_001295557.1.29815 WP_001295557.1.29820 WP_001295557.1.29821 WP_001295557.1.29840 WP_001295557.1.2986 WP_001295557.1.29874 WP_001295557.1.29876 WP_001295557.1.29884 WP_001295557.1.29933 WP_001295557.1.2995 WP_001295557.1.29967 WP_001295557.1.29979 WP_001295557.1.29988 WP_001295557.1.29992 WP_001295557.1.30004 WP_001295557.1.30016 WP_001295557.1.30035 WP_001295557.1.30063 WP_001295557.1.30098 WP_001295557.1.30123 WP_001295557.1.30141 WP_001295557.1.3018 WP_001295557.1.30221 WP_001295557.1.30232 WP_001295557.1.30239 WP_001295557.1.30247 WP_001295557.1.30253 WP_001295557.1.30269 WP_001295557.1.30298 WP_001295557.1.30347 WP_001295557.1.30397 WP_001295557.1.30399 WP_001295557.1.30401 WP_001295557.1.30428 WP_001295557.1.30447 WP_001295557.1.3045 WP_001295557.1.30452 WP_001295557.1.30472 WP_001295557.1.30479 WP_001295557.1.30497 WP_001295557.1.30524 WP_001295557.1.30546 WP_001295557.1.3055 WP_001295557.1.30550 WP_001295557.1.30554 WP_001295557.1.30570 WP_001295557.1.30580 WP_001295557.1.306 WP_001295557.1.3063 WP_001295557.1.30630 WP_001295557.1.30639 WP_001295557.1.30658 WP_001295557.1.30665 WP_001295557.1.30691 WP_001295557.1.30700 WP_001295557.1.30733 WP_001295557.1.30742 WP_001295557.1.30749 WP_001295557.1.30762 WP_001295557.1.30783 WP_001295557.1.30808 WP_001295557.1.3083 WP_001295557.1.30843 WP_001295557.1.30866 WP_001295557.1.30867 WP_001295557.1.30879 WP_001295557.1.30887 WP_001295557.1.30896 WP_001295557.1.30905 WP_001295557.1.30960 WP_001295557.1.30987 WP_001295557.1.31000 WP_001295557.1.31009 WP_001295557.1.31017 WP_001295557.1.31026 WP_001295557.1.31029 WP_001295557.1.31083 WP_001295557.1.31089 WP_001295557.1.31119 WP_001295557.1.31129 WP_001295557.1.31142 WP_001295557.1.31154 WP_001295557.1.31188 WP_001295557.1.31211 WP_001295557.1.31295 WP_001295557.1.31319 WP_001295557.1.31340 WP_001295557.1.31347 WP_001295557.1.31353 WP_001295557.1.31357 WP_001295557.1.31379 WP_001295557.1.31407 WP_001295557.1.31419 WP_001295557.1.31421 WP_001295557.1.31422 WP_001295557.1.31429 WP_001295557.1.31431 WP_001295557.1.31433 WP_001295557.1.31434 WP_001295557.1.3147 WP_001295557.1.31482 WP_001295557.1.31506 WP_001295557.1.31511 WP_001295557.1.31518 WP_001295557.1.31521 WP_001295557.1.31527 WP_001295557.1.31557 WP_001295557.1.31559 WP_001295557.1.31596 WP_001295557.1.31614 WP_001295557.1.31625 WP_001295557.1.31639 WP_001295557.1.31657 WP_001295557.1.31675 WP_001295557.1.31679 WP_001295557.1.31681 WP_001295557.1.3169 WP_001295557.1.31696 WP_001295557.1.31709 WP_001295557.1.31736 WP_001295557.1.31740 WP_001295557.1.31801 WP_001295557.1.31803 WP_001295557.1.3181 WP_001295557.1.31823 WP_001295557.1.31825 WP_001295557.1.31833 WP_001295557.1.31835 WP_001295557.1.31839 WP_001295557.1.31860 WP_001295557.1.31863 WP_001295557.1.31866 WP_001295557.1.31899 WP_001295557.1.31903 WP_001295557.1.31924 WP_001295557.1.31928 WP_001295557.1.3193 WP_001295557.1.31937 WP_001295557.1.31978 WP_001295557.1.3201 WP_001295557.1.32020 WP_001295557.1.32021 WP_001295557.1.32024 WP_001295557.1.3203 WP_001295557.1.32030 WP_001295557.1.32037 WP_001295557.1.32049 WP_001295557.1.32078 WP_001295557.1.32089 WP_001295557.1.32091 WP_001295557.1.32093 WP_001295557.1.3212 WP_001295557.1.32121 WP_001295557.1.32127 WP_001295557.1.32138 WP_001295557.1.32142 WP_001295557.1.32143 WP_001295557.1.3215 WP_001295557.1.32173 WP_001295557.1.32222 WP_001295557.1.32225 WP_001295557.1.32232 WP_001295557.1.32234 WP_001295557.1.32236 WP_001295557.1.32242 WP_001295557.1.32279 WP_001295557.1.32287 WP_001295557.1.3233 WP_001295557.1.32333 WP_001295557.1.32394 WP_001295557.1.32432 WP_001295557.1.32435 WP_001295557.1.32443 WP_001295557.1.32448 WP_001295557.1.3247 WP_001295557.1.32475 WP_001295557.1.32479 WP_001295557.1.3248 WP_001295557.1.32480 WP_001295557.1.32494 WP_001295557.1.32509 WP_001295557.1.32518 WP_001295557.1.32558 WP_001295557.1.32561 WP_001295557.1.32580 WP_001295557.1.32587 WP_001295557.1.3259 WP_001295557.1.32591 WP_001295557.1.32601 WP_001295557.1.32635 WP_001295557.1.32655 WP_001295557.1.32676 WP_001295557.1.32680 WP_001295557.1.3269 WP_001295557.1.327 WP_001295557.1.32709 WP_001295557.1.32715 WP_001295557.1.32718 WP_001295557.1.32720 WP_001295557.1.32722 WP_001295557.1.32724 WP_001295557.1.32741 WP_001295557.1.32772 WP_001295557.1.32811 WP_001295557.1.32815 WP_001295557.1.32831 WP_001295557.1.32835 WP_001295557.1.32875 WP_001295557.1.32903 WP_001295557.1.32910 WP_001295557.1.32938 WP_001295557.1.32946 WP_001295557.1.3295 WP_001295557.1.32959 WP_001295557.1.32972 WP_001295557.1.32984 WP_001295557.1.32992 WP_001295557.1.32995 WP_001295557.1.33004 WP_001295557.1.33014 WP_001295557.1.33018 WP_001295557.1.33022 WP_001295557.1.33026 WP_001295557.1.33046 WP_001295557.1.33053 WP_001295557.1.33171 WP_001295557.1.33179 WP_001295557.1.33190 WP_001295557.1.33217 WP_001295557.1.3323 WP_001295557.1.33237 WP_001295557.1.33238 WP_001295557.1.33244 WP_001295557.1.33303 WP_001295557.1.33325 WP_001295557.1.33341 WP_001295557.1.33352 WP_001295557.1.33362 WP_001295557.1.33385 WP_001295557.1.33408 WP_001295557.1.33410 WP_001295557.1.33413 WP_001295557.1.33422 WP_001295557.1.33424 WP_001295557.1.33428 WP_001295557.1.3344 WP_001295557.1.33502 WP_001295557.1.33512 WP_001295557.1.33525 WP_001295557.1.33526 WP_001295557.1.3354 WP_001295557.1.33545 WP_001295557.1.33561 WP_001295557.1.33563 WP_001295557.1.33565 WP_001295557.1.33584 WP_001295557.1.33595 WP_001295557.1.33631 WP_001295557.1.33638 WP_001295557.1.33648 WP_001295557.1.33680 WP_001295557.1.33729 WP_001295557.1.33736 WP_001295557.1.33745 WP_001295557.1.33746 WP_001295557.1.33751 WP_001295557.1.33780 WP_001295557.1.33799 WP_001295557.1.33823 WP_001295557.1.33853 WP_001295557.1.33854 WP_001295557.1.33879 WP_001295557.1.33888 WP_001295557.1.33914 WP_001295557.1.33948 WP_001295557.1.33952 WP_001295557.1.33973 WP_001295557.1.33974 WP_001295557.1.33979 WP_001295557.1.3398 WP_001295557.1.34003 WP_001295557.1.3401 WP_001295557.1.34032 WP_001295557.1.34094 WP_001295557.1.3411 WP_001295557.1.34117 WP_001295557.1.34121 WP_001295557.1.34124 WP_001295557.1.34130 WP_001295557.1.3415 WP_001295557.1.342 WP_001295557.1.34204 WP_001295557.1.34224 WP_001295557.1.34270 WP_001295557.1.34273 WP_001295557.1.34294 WP_001295557.1.34303 WP_001295557.1.3432 WP_001295557.1.34332 WP_001295557.1.34341 WP_001295557.1.34363 WP_001295557.1.34380 WP_001295557.1.3439 WP_001295557.1.34397 WP_001295557.1.34400 WP_001295557.1.34422 WP_001295557.1.3444 WP_001295557.1.34440 WP_001295557.1.34444 WP_001295557.1.34464 WP_001295557.1.34525 WP_001295557.1.34528 WP_001295557.1.34532 WP_001295557.1.34538 WP_001295557.1.34541 WP_001295557.1.34557 WP_001295557.1.3460 WP_001295557.1.34605 WP_001295557.1.34617 WP_001295557.1.34655 WP_001295557.1.34668 WP_001295557.1.34682 WP_001295557.1.34683 WP_001295557.1.3469 WP_001295557.1.347 WP_001295557.1.34727 WP_001295557.1.34763 WP_001295557.1.34781 WP_001295557.1.34782 WP_001295557.1.34794 WP_001295557.1.34827 WP_001295557.1.34835 WP_001295557.1.34855 WP_001295557.1.34875 WP_001295557.1.34887 WP_001295557.1.34913 WP_001295557.1.34931 WP_001295557.1.34948 WP_001295557.1.34966 WP_001295557.1.34982 WP_001295557.1.34983 WP_001295557.1.34990 WP_001295557.1.34993 WP_001295557.1.35003 WP_001295557.1.35006 WP_001295557.1.35007 WP_001295557.1.35012 WP_001295557.1.35039 WP_001295557.1.35114 WP_001295557.1.35127 WP_001295557.1.3515 WP_001295557.1.35180 WP_001295557.1.35186 WP_001295557.1.35195 WP_001295557.1.35198 WP_001295557.1.35202 WP_001295557.1.35204 WP_001295557.1.35208 WP_001295557.1.3521 WP_001295557.1.35211 WP_001295557.1.35220 WP_001295557.1.35253 WP_001295557.1.35258 WP_001295557.1.35316 WP_001295557.1.35328 WP_001295557.1.35365 WP_001295557.1.35376 WP_001295557.1.3539 WP_001295557.1.35398 WP_001295557.1.35448 WP_001295557.1.35465 WP_001295557.1.35466 WP_001295557.1.35468 WP_001295557.1.35483 WP_001295557.1.35552 WP_001295557.1.35581 WP_001295557.1.3560 WP_001295557.1.35604 WP_001295557.1.35627 WP_001295557.1.35632 WP_001295557.1.35651 WP_001295557.1.35653 WP_001295557.1.35654 WP_001295557.1.35704 WP_001295557.1.35724 WP_001295557.1.35740 WP_001295557.1.35744 WP_001295557.1.35904 WP_001295557.1.35922 WP_001295557.1.35927 WP_001295557.1.35942 WP_001295557.1.35959 WP_001295557.1.35963 WP_001295557.1.3598 WP_001295557.1.35983 WP_001295557.1.35987 WP_001295557.1.35990 WP_001295557.1.3600 WP_001295557.1.36040 WP_001295557.1.36042 WP_001295557.1.36070 WP_001295557.1.36071 WP_001295557.1.36085 WP_001295557.1.36094 WP_001295557.1.36132 WP_001295557.1.36158 WP_001295557.1.36159 WP_001295557.1.36164 WP_001295557.1.36166 WP_001295557.1.36177 WP_001295557.1.36182 WP_001295557.1.3620 WP_001295557.1.36207 WP_001295557.1.3624 WP_001295557.1.36281 WP_001295557.1.36299 WP_001295557.1.36332 WP_001295557.1.36334 WP_001295557.1.36352 WP_001295557.1.36386 WP_001295557.1.36393 WP_001295557.1.36405 WP_001295557.1.36412 WP_001295557.1.36414 WP_001295557.1.36426 WP_001295557.1.3643 WP_001295557.1.36453 WP_001295557.1.36496 WP_001295557.1.365 WP_001295557.1.36500 WP_001295557.1.36507 WP_001295557.1.36523 WP_001295557.1.36531 WP_001295557.1.36537 WP_001295557.1.36545 WP_001295557.1.36610 WP_001295557.1.36627 WP_001295557.1.36628 WP_001295557.1.36667 WP_001295557.1.36699 WP_001295557.1.36707 WP_001295557.1.3671 WP_001295557.1.36724 WP_001295557.1.36739 WP_001295557.1.36746 WP_001295557.1.36747 WP_001295557.1.36761 WP_001295557.1.36799 WP_001295557.1.36806 WP_001295557.1.36812 WP_001295557.1.36817 WP_001295557.1.36826 WP_001295557.1.36856 WP_001295557.1.36904 WP_001295557.1.36925 WP_001295557.1.3697 WP_001295557.1.36971 WP_001295557.1.36975 WP_001295557.1.37006 WP_001295557.1.37020 WP_001295557.1.37046 WP_001295557.1.37049 WP_001295557.1.37057 WP_001295557.1.37076 WP_001295557.1.37099 WP_001295557.1.37101 WP_001295557.1.37103 WP_001295557.1.37122 WP_001295557.1.37146 WP_001295557.1.37153 WP_001295557.1.3723 WP_001295557.1.37233 WP_001295557.1.37252 WP_001295557.1.37261 WP_001295557.1.37266 WP_001295557.1.37290 WP_001295557.1.3730 WP_001295557.1.37306 WP_001295557.1.37312 WP_001295557.1.37313 WP_001295557.1.37329 WP_001295557.1.37334 WP_001295557.1.37342 WP_001295557.1.37352 WP_001295557.1.37360 WP_001295557.1.37371 WP_001295557.1.37388 WP_001295557.1.37419 WP_001295557.1.37423 WP_001295557.1.37433 WP_001295557.1.37445 WP_001295557.1.37472 WP_001295557.1.37476 WP_001295557.1.37485 WP_001295557.1.3749 WP_001295557.1.37510 WP_001295557.1.37516 WP_001295557.1.37538 WP_001295557.1.37543 WP_001295557.1.37544 WP_001295557.1.37548 WP_001295557.1.37550 WP_001295557.1.37554 WP_001295557.1.37576 WP_001295557.1.37588 WP_001295557.1.37592 WP_001295557.1.37608 WP_001295557.1.37634 WP_001295557.1.37664 WP_001295557.1.377 WP_001295557.1.3772 WP_001295557.1.37736 WP_001295557.1.37745 WP_001295557.1.37750 WP_001295557.1.37758 WP_001295557.1.37762 WP_001295557.1.37766 WP_001295557.1.37773 WP_001295557.1.37817 WP_001295557.1.37847 WP_001295557.1.37852 WP_001295557.1.37853 WP_001295557.1.3788 WP_001295557.1.37880 WP_001295557.1.37887 WP_001295557.1.37897 WP_001295557.1.37917 WP_001295557.1.37923 WP_001295557.1.37926 WP_001295557.1.37940 WP_001295557.1.3796 WP_001295557.1.37962 WP_001295557.1.37964 WP_001295557.1.37967 WP_001295557.1.37984 WP_001295557.1.37995 WP_001295557.1.37998 WP_001295557.1.38000 WP_001295557.1.38033 WP_001295557.1.38043 WP_001295557.1.38080 WP_001295557.1.38081 WP_001295557.1.38085 WP_001295557.1.38103 WP_001295557.1.38105 WP_001295557.1.3811 WP_001295557.1.38120 WP_001295557.1.3815 WP_001295557.1.38155 WP_001295557.1.38162 WP_001295557.1.38182 WP_001295557.1.38185 WP_001295557.1.38194 WP_001295557.1.38211 WP_001295557.1.3822 WP_001295557.1.38234 WP_001295557.1.38257 WP_001295557.1.38264 WP_001295557.1.38293 WP_001295557.1.38300 WP_001295557.1.38314 WP_001295557.1.38323 WP_001295557.1.38357 WP_001295557.1.38363 WP_001295557.1.38371 WP_001295557.1.38392 WP_001295557.1.38412 WP_001295557.1.38419 WP_001295557.1.38485 WP_001295557.1.38533 WP_001295557.1.38544 WP_001295557.1.38561 WP_001295557.1.38567 WP_001295557.1.38610 WP_001295557.1.38626 WP_001295557.1.38629 WP_001295557.1.38636 WP_001295557.1.38694 WP_001295557.1.3873 WP_001295557.1.38751 WP_001295557.1.38777 WP_001295557.1.38782 WP_001295557.1.38811 WP_001295557.1.38827 WP_001295557.1.38835 WP_001295557.1.38843 WP_001295557.1.38896 WP_001295557.1.38911 WP_001295557.1.38920 WP_001295557.1.38935 WP_001295557.1.38937 WP_001295557.1.38950 WP_001295557.1.38956 WP_001295557.1.39005 WP_001295557.1.39015 WP_001295557.1.3903 WP_001295557.1.39037 WP_001295557.1.3904 WP_001295557.1.39042 WP_001295557.1.39103 WP_001295557.1.39111 WP_001295557.1.3912 WP_001295557.1.39123 WP_001295557.1.39148 WP_001295557.1.39150 WP_001295557.1.39155 WP_001295557.1.39157 WP_001295557.1.39164 WP_001295557.1.39167 WP_001295557.1.39171 WP_001295557.1.39184 WP_001295557.1.39196 WP_001295557.1.39209 WP_001295557.1.3921 WP_001295557.1.39232 WP_001295557.1.39249 WP_001295557.1.39254 WP_001295557.1.39289 WP_001295557.1.39302 WP_001295557.1.39305 WP_001295557.1.39325 WP_001295557.1.39327 WP_001295557.1.39335 WP_001295557.1.39342 WP_001295557.1.39356 WP_001295557.1.39365 WP_001295557.1.39367 WP_001295557.1.39373 WP_001295557.1.39401 WP_001295557.1.39402 WP_001295557.1.39423 WP_001295557.1.39430 WP_001295557.1.39468 WP_001295557.1.39481 WP_001295557.1.39492 WP_001295557.1.39509 WP_001295557.1.39531 WP_001295557.1.3954 WP_001295557.1.39541 WP_001295557.1.39575 WP_001295557.1.39580 WP_001295557.1.39594 WP_001295557.1.39606 WP_001295557.1.39607 WP_001295557.1.39610 WP_001295557.1.39636 WP_001295557.1.39690 WP_001295557.1.3970 WP_001295557.1.39708 WP_001295557.1.39709 WP_001295557.1.39713 WP_001295557.1.39715 WP_001295557.1.39717 WP_001295557.1.39726 WP_001295557.1.39730 WP_001295557.1.39733 WP_001295557.1.39758 WP_001295557.1.39796 WP_001295557.1.3980 WP_001295557.1.39809 WP_001295557.1.39818 WP_001295557.1.39822 WP_001295557.1.39829 WP_001295557.1.39867 WP_001295557.1.39870 WP_001295557.1.39892 WP_001295557.1.39938 WP_001295557.1.39961 WP_001295557.1.39966 WP_001295557.1.39970 WP_001295557.1.39973 WP_001295557.1.39992 WP_001295557.1.39998 WP_001295557.1.40 WP_001295557.1.40013 WP_001295557.1.40016 WP_001295557.1.40083 WP_001295557.1.40088 WP_001295557.1.40107 WP_001295557.1.40121 WP_001295557.1.40147 WP_001295557.1.40153 WP_001295557.1.40159 WP_001295557.1.40183 WP_001295557.1.40190 WP_001295557.1.40192 WP_001295557.1.4020 WP_001295557.1.40206 WP_001295557.1.40211 WP_001295557.1.40212 WP_001295557.1.40218 WP_001295557.1.40238 WP_001295557.1.40249 WP_001295557.1.40300 WP_001295557.1.40315 WP_001295557.1.40317 WP_001295557.1.40319 WP_001295557.1.40335 WP_001295557.1.40345 WP_001295557.1.40360 WP_001295557.1.40382 WP_001295557.1.40389 WP_001295557.1.40391 WP_001295557.1.40403 WP_001295557.1.40445 WP_001295557.1.4049 WP_001295557.1.40499 WP_001295557.1.40502 WP_001295557.1.40509 WP_001295557.1.40524 WP_001295557.1.40539 WP_001295557.1.40548 WP_001295557.1.40560 WP_001295557.1.40563 WP_001295557.1.40596 WP_001295557.1.40599 WP_001295557.1.406 WP_001295557.1.40607 WP_001295557.1.40617 WP_001295557.1.40623 WP_001295557.1.40636 WP_001295557.1.40657 WP_001295557.1.40660 WP_001295557.1.40666 WP_001295557.1.40668 WP_001295557.1.40686 WP_001295557.1.40712 WP_001295557.1.40715 WP_001295557.1.4081 WP_001295557.1.40813 WP_001295557.1.40815 WP_001295557.1.4082 WP_001295557.1.40833 WP_001295557.1.40842 WP_001295557.1.40865 WP_001295557.1.40898 WP_001295557.1.40912 WP_001295557.1.40937 WP_001295557.1.40965 WP_001295557.1.41037 WP_001295557.1.41045 WP_001295557.1.41113 WP_001295557.1.41125 WP_001295557.1.41147 WP_001295557.1.41206 WP_001295557.1.4122 WP_001295557.1.41230 WP_001295557.1.41239 WP_001295557.1.41244 WP_001295557.1.41259 WP_001295557.1.4126 WP_001295557.1.41263 WP_001295557.1.41271 WP_001295557.1.41315 WP_001295557.1.41363 WP_001295557.1.41368 WP_001295557.1.41371 WP_001295557.1.41392 WP_001295557.1.41394 WP_001295557.1.41401 WP_001295557.1.41402 WP_001295557.1.41407 WP_001295557.1.41417 WP_001295557.1.4142 WP_001295557.1.41436 WP_001295557.1.41453 WP_001295557.1.41455 WP_001295557.1.41457 WP_001295557.1.41466 WP_001295557.1.41479 WP_001295557.1.41481 WP_001295557.1.41482 WP_001295557.1.41483 WP_001295557.1.41484 WP_001295557.1.41488 WP_001295557.1.41530 WP_001295557.1.41545 WP_001295557.1.41556 WP_001295557.1.41566 WP_001295557.1.4158 WP_001295557.1.41606 WP_001295557.1.41613 WP_001295557.1.41621 WP_001295557.1.41651 WP_001295557.1.41654 WP_001295557.1.41718 WP_001295557.1.4172 WP_001295557.1.41740 WP_001295557.1.41752 WP_001295557.1.41778 WP_001295557.1.41780 WP_001295557.1.41782 WP_001295557.1.41783 WP_001295557.1.41784 WP_001295557.1.41812 WP_001295557.1.41826 WP_001295557.1.41837 WP_001295557.1.41847 WP_001295557.1.41884 WP_001295557.1.4189 WP_001295557.1.41900 WP_001295557.1.41923 WP_001295557.1.4193 WP_001295557.1.41956 WP_001295557.1.41960 WP_001295557.1.41964 WP_001295557.1.41988 WP_001295557.1.41990 WP_001295557.1.41991 WP_001295557.1.42022 WP_001295557.1.42027 WP_001295557.1.42033 WP_001295557.1.42038 WP_001295557.1.42044 WP_001295557.1.42060 WP_001295557.1.42073 WP_001295557.1.42095 WP_001295557.1.42096 WP_001295557.1.42113 WP_001295557.1.42138 WP_001295557.1.4214 WP_001295557.1.42159 WP_001295557.1.42179 WP_001295557.1.42203 WP_001295557.1.42209 WP_001295557.1.42214 WP_001295557.1.42221 WP_001295557.1.42226 WP_001295557.1.42228 WP_001295557.1.42233 WP_001295557.1.4224 WP_001295557.1.42252 WP_001295557.1.42258 WP_001295557.1.42277 WP_001295557.1.42284 WP_001295557.1.42300 WP_001295557.1.42318 WP_001295557.1.42350 WP_001295557.1.42359 WP_001295557.1.42367 WP_001295557.1.42369 WP_001295557.1.42376 WP_001295557.1.42387 WP_001295557.1.42413 WP_001295557.1.42415 WP_001295557.1.4242 WP_001295557.1.42432 WP_001295557.1.42442 WP_001295557.1.42456 WP_001295557.1.42480 WP_001295557.1.42522 WP_001295557.1.42547 WP_001295557.1.42586 WP_001295557.1.42597 WP_001295557.1.42601 WP_001295557.1.42632 WP_001295557.1.42638 WP_001295557.1.42661 WP_001295557.1.42669 WP_001295557.1.42670 WP_001295557.1.42677 WP_001295557.1.42709 WP_001295557.1.42728 WP_001295557.1.42748 WP_001295557.1.42749 WP_001295557.1.42750 WP_001295557.1.42756 WP_001295557.1.42761 WP_001295557.1.42770 WP_001295557.1.42771 WP_001295557.1.42791 WP_001295557.1.42804 WP_001295557.1.42808 WP_001295557.1.42813 WP_001295557.1.4282 WP_001295557.1.42828 WP_001295557.1.42830 WP_001295557.1.42832 WP_001295557.1.42879 WP_001295557.1.42891 WP_001295557.1.4290 WP_001295557.1.42903 WP_001295557.1.42918 WP_001295557.1.42936 WP_001295557.1.42937 WP_001295557.1.42950 WP_001295557.1.42962 WP_001295557.1.42966 WP_001295557.1.42970 WP_001295557.1.42987 WP_001295557.1.42989 WP_001295557.1.42991 WP_001295557.1.43027 WP_001295557.1.43035 WP_001295557.1.4306 WP_001295557.1.43137 WP_001295557.1.43166 WP_001295557.1.43170 WP_001295557.1.43174 WP_001295557.1.43177 WP_001295557.1.43213 WP_001295557.1.43216 WP_001295557.1.43239 WP_001295557.1.43270 WP_001295557.1.43278 WP_001295557.1.43316 WP_001295557.1.43324 WP_001295557.1.4334 WP_001295557.1.43363 WP_001295557.1.43374 WP_001295557.1.43389 WP_001295557.1.4342 WP_001295557.1.43422 WP_001295557.1.4343 WP_001295557.1.43444 WP_001295557.1.43455 WP_001295557.1.43473 WP_001295557.1.43474 WP_001295557.1.43489 WP_001295557.1.4356 WP_001295557.1.43566 WP_001295557.1.43598 WP_001295557.1.43604 WP_001295557.1.43622 WP_001295557.1.43642 WP_001295557.1.43720 WP_001295557.1.43733 WP_001295557.1.43738 WP_001295557.1.43750 WP_001295557.1.43769 WP_001295557.1.43803 WP_001295557.1.43804 WP_001295557.1.43858 WP_001295557.1.43868 WP_001295557.1.43898 WP_001295557.1.43925 WP_001295557.1.43942 WP_001295557.1.43953 WP_001295557.1.43966 WP_001295557.1.440 WP_001295557.1.4400 WP_001295557.1.44018 WP_001295557.1.44020 WP_001295557.1.44029 WP_001295557.1.44040 WP_001295557.1.44051 WP_001295557.1.44075 WP_001295557.1.44077 WP_001295557.1.44088 WP_001295557.1.44096 WP_001295557.1.44100 WP_001295557.1.4411 WP_001295557.1.44115 WP_001295557.1.4415 WP_001295557.1.44162 WP_001295557.1.44166 WP_001295557.1.44203 WP_001295557.1.44211 WP_001295557.1.44238 WP_001295557.1.44251 WP_001295557.1.44263 WP_001295557.1.44264 WP_001295557.1.44273 WP_001295557.1.44285 WP_001295557.1.44287 WP_001295557.1.44292 WP_001295557.1.44314 WP_001295557.1.44324 WP_001295557.1.44365 WP_001295557.1.44394 WP_001295557.1.44422 WP_001295557.1.44424 WP_001295557.1.44426 WP_001295557.1.44445 WP_001295557.1.44447 WP_001295557.1.44452 WP_001295557.1.44458 WP_001295557.1.44460 WP_001295557.1.44461 WP_001295557.1.4449 WP_001295557.1.44524 WP_001295557.1.44539 WP_001295557.1.44558 WP_001295557.1.44570 WP_001295557.1.44608 WP_001295557.1.44610 WP_001295557.1.44622 WP_001295557.1.4463 WP_001295557.1.44642 WP_001295557.1.44649 WP_001295557.1.44661 WP_001295557.1.44668 WP_001295557.1.44686 WP_001295557.1.44724 WP_001295557.1.4473 WP_001295557.1.44756 WP_001295557.1.44759 WP_001295557.1.44784 WP_001295557.1.448 WP_001295557.1.44814 WP_001295557.1.44818 WP_001295557.1.44836 WP_001295557.1.44840 WP_001295557.1.44841 WP_001295557.1.44843 WP_001295557.1.44848 WP_001295557.1.44849 WP_001295557.1.44854 WP_001295557.1.44855 WP_001295557.1.44857 WP_001295557.1.44923 WP_001295557.1.44960 WP_001295557.1.44970 WP_001295557.1.44975 WP_001295557.1.44977 WP_001295557.1.44980 WP_001295557.1.45025 WP_001295557.1.45043 WP_001295557.1.45053 WP_001295557.1.45068 WP_001295557.1.45104 WP_001295557.1.45116 WP_001295557.1.45156 WP_001295557.1.4516 WP_001295557.1.45208 WP_001295557.1.4524 WP_001295557.1.45246 WP_001295557.1.45301 WP_001295557.1.45313 WP_001295557.1.45329 WP_001295557.1.45359 WP_001295557.1.45404 WP_001295557.1.45405 WP_001295557.1.4541 WP_001295557.1.45440 WP_001295557.1.45444 WP_001295557.1.45486 WP_001295557.1.4549 WP_001295557.1.45494 WP_001295557.1.45500 WP_001295557.1.45536 WP_001295557.1.45538 WP_001295557.1.45565 WP_001295557.1.45581 WP_001295557.1.45595 WP_001295557.1.45627 WP_001295557.1.4563 WP_001295557.1.45664 WP_001295557.1.45674 WP_001295557.1.45676 WP_001295557.1.4570 WP_001295557.1.45718 WP_001295557.1.4574 WP_001295557.1.45741 WP_001295557.1.45752 WP_001295557.1.4576 WP_001295557.1.45793 WP_001295557.1.45806 WP_001295557.1.4583 WP_001295557.1.45840 WP_001295557.1.45846 WP_001295557.1.45868 WP_001295557.1.45921 WP_001295557.1.4593 WP_001295557.1.45930 WP_001295557.1.45933 WP_001295557.1.45945 WP_001295557.1.45960 WP_001295557.1.45962 WP_001295557.1.45968 WP_001295557.1.45990 WP_001295557.1.45991 WP_001295557.1.4600 WP_001295557.1.46016 WP_001295557.1.46026 WP_001295557.1.46048 WP_001295557.1.46049 WP_001295557.1.46070 WP_001295557.1.46081 WP_001295557.1.46097 WP_001295557.1.4610 WP_001295557.1.46105 WP_001295557.1.46115 WP_001295557.1.46122 WP_001295557.1.4613 WP_001295557.1.46164 WP_001295557.1.4617 WP_001295557.1.46186 WP_001295557.1.46197 WP_001295557.1.46213 WP_001295557.1.46217 WP_001295557.1.46239 WP_001295557.1.46245 WP_001295557.1.46257 WP_001295557.1.46263 WP_001295557.1.46291 WP_001295557.1.46301 WP_001295557.1.46325 WP_001295557.1.46329 WP_001295557.1.46378 WP_001295557.1.46379 WP_001295557.1.4643 WP_001295557.1.46433 WP_001295557.1.46441 WP_001295557.1.4646 WP_001295557.1.46468 WP_001295557.1.4647 WP_001295557.1.46477 WP_001295557.1.46487 WP_001295557.1.46526 WP_001295557.1.46541 WP_001295557.1.46552 WP_001295557.1.46555 WP_001295557.1.4657 WP_001295557.1.46573 WP_001295557.1.46582 WP_001295557.1.46589 WP_001295557.1.46594 WP_001295557.1.46602 WP_001295557.1.46614 WP_001295557.1.46616 WP_001295557.1.46643 WP_001295557.1.46655 WP_001295557.1.46668 WP_001295557.1.4670 WP_001295557.1.46734 WP_001295557.1.46743 WP_001295557.1.46798 WP_001295557.1.46802 WP_001295557.1.46806 WP_001295557.1.46820 WP_001295557.1.46821 WP_001295557.1.46833 WP_001295557.1.46841 WP_001295557.1.46857 WP_001295557.1.46860 WP_001295557.1.46876 WP_001295557.1.46882 WP_001295557.1.46898 WP_001295557.1.46909 WP_001295557.1.4691 WP_001295557.1.46912 WP_001295557.1.46932 WP_001295557.1.4695 WP_001295557.1.46990 WP_001295557.1.46991 WP_001295557.1.46994 WP_001295557.1.46999 WP_001295557.1.47024 WP_001295557.1.47028 WP_001295557.1.47029 WP_001295557.1.47030 WP_001295557.1.47034 WP_001295557.1.47038 WP_001295557.1.47039 WP_001295557.1.47048 WP_001295557.1.47050 WP_001295557.1.47054 WP_001295557.1.47063 WP_001295557.1.47069 WP_001295557.1.47124 WP_001295557.1.47135 WP_001295557.1.47156 WP_001295557.1.47167 WP_001295557.1.47186 WP_001295557.1.47197 WP_001295557.1.4722 WP_001295557.1.47224 WP_001295557.1.47247 WP_001295557.1.4725 WP_001295557.1.47280 WP_001295557.1.47307 WP_001295557.1.47316 WP_001295557.1.47319 WP_001295557.1.47322 WP_001295557.1.47332 WP_001295557.1.47344 WP_001295557.1.47349 WP_001295557.1.47350 WP_001295557.1.47356 WP_001295557.1.47363 WP_001295557.1.47370 WP_001295557.1.47386 WP_001295557.1.4740 WP_001295557.1.47414 WP_001295557.1.47416 WP_001295557.1.47425 WP_001295557.1.4743 WP_001295557.1.47451 WP_001295557.1.47473 WP_001295557.1.47477 WP_001295557.1.47488 WP_001295557.1.47496 WP_001295557.1.47498 WP_001295557.1.47500 WP_001295557.1.47529 WP_001295557.1.47533 WP_001295557.1.47546 WP_001295557.1.47555 WP_001295557.1.47582 WP_001295557.1.47599 WP_001295557.1.47634 WP_001295557.1.47646 WP_001295557.1.47654 WP_001295557.1.47662 WP_001295557.1.47673 WP_001295557.1.47709 WP_001295557.1.4772 WP_001295557.1.47722 WP_001295557.1.4773 WP_001295557.1.47734 WP_001295557.1.47740 WP_001295557.1.47744 WP_001295557.1.47761 WP_001295557.1.47764 WP_001295557.1.47765 WP_001295557.1.47770 WP_001295557.1.47790 WP_001295557.1.47791 WP_001295557.1.47820 WP_001295557.1.4783 WP_001295557.1.47848 WP_001295557.1.4785 WP_001295557.1.47914 WP_001295557.1.47935 WP_001295557.1.4796 WP_001295557.1.47962 WP_001295557.1.47981 WP_001295557.1.47983 WP_001295557.1.48000 WP_001295557.1.48018 WP_001295557.1.48029 WP_001295557.1.48040 WP_001295557.1.48048 WP_001295557.1.48051 WP_001295557.1.48073 WP_001295557.1.48077 WP_001295557.1.48080 WP_001295557.1.48087 WP_001295557.1.48090 WP_001295557.1.48096 WP_001295557.1.4811 WP_001295557.1.48111 WP_001295557.1.48121 WP_001295557.1.48144 WP_001295557.1.48168 WP_001295557.1.48188 WP_001295557.1.48194 WP_001295557.1.48203 WP_001295557.1.48216 WP_001295557.1.48222 WP_001295557.1.4826 WP_001295557.1.48265 WP_001295557.1.48285 WP_001295557.1.48290 WP_001295557.1.48291 WP_001295557.1.48317 WP_001295557.1.48355 WP_001295557.1.48371 WP_001295557.1.48385 WP_001295557.1.48404 WP_001295557.1.48417 WP_001295557.1.48421 WP_001295557.1.48433 WP_001295557.1.48469 WP_001295557.1.48477 WP_001295557.1.48480 WP_001295557.1.48483 WP_001295557.1.48505 WP_001295557.1.48522 WP_001295557.1.4857 WP_001295557.1.48571 WP_001295557.1.48590 WP_001295557.1.486 WP_001295557.1.48602 WP_001295557.1.48615 WP_001295557.1.48620 WP_001295557.1.48626 WP_001295557.1.48629 WP_001295557.1.48678 WP_001295557.1.4871 WP_001295557.1.4876 WP_001295557.1.48771 WP_001295557.1.48801 WP_001295557.1.48808 WP_001295557.1.48825 WP_001295557.1.48827 WP_001295557.1.48847 WP_001295557.1.48860 WP_001295557.1.48901 WP_001295557.1.48902 WP_001295557.1.48907 WP_001295557.1.48910 WP_001295557.1.4892 WP_001295557.1.48921 WP_001295557.1.48926 WP_001295557.1.48928 WP_001295557.1.48953 WP_001295557.1.48954 WP_001295557.1.48970 WP_001295557.1.48974 WP_001295557.1.49001 WP_001295557.1.49009 WP_001295557.1.49061 WP_001295557.1.49104 WP_001295557.1.49107 WP_001295557.1.49124 WP_001295557.1.49136 WP_001295557.1.49190 WP_001295557.1.49229 WP_001295557.1.49236 WP_001295557.1.49243 WP_001295557.1.49258 WP_001295557.1.49259 WP_001295557.1.49275 WP_001295557.1.49312 WP_001295557.1.49321 WP_001295557.1.49336 WP_001295557.1.49338 WP_001295557.1.49342 WP_001295557.1.49347 WP_001295557.1.49412 WP_001295557.1.49431 WP_001295557.1.49446 WP_001295557.1.49459 WP_001295557.1.49481 WP_001295557.1.49482 WP_001295557.1.4949 WP_001295557.1.49521 WP_001295557.1.49522 WP_001295557.1.49528 WP_001295557.1.49531 WP_001295557.1.49537 WP_001295557.1.49558 WP_001295557.1.49594 WP_001295557.1.49599 WP_001295557.1.49615 WP_001295557.1.49621 WP_001295557.1.49625 WP_001295557.1.49645 WP_001295557.1.49661 WP_001295557.1.49662 WP_001295557.1.49675 WP_001295557.1.49684 WP_001295557.1.497 WP_001295557.1.49712 WP_001295557.1.49722 WP_001295557.1.49733 WP_001295557.1.49740 WP_001295557.1.49747 WP_001295557.1.49768 WP_001295557.1.49774 WP_001295557.1.49777 WP_001295557.1.49783 WP_001295557.1.49820 WP_001295557.1.4985 WP_001295557.1.49856 WP_001295557.1.49861 WP_001295557.1.49879 WP_001295557.1.49883 WP_001295557.1.49884 WP_001295557.1.49900 WP_001295557.1.49902 WP_001295557.1.49941 WP_001295557.1.49950 WP_001295557.1.49954 WP_001295557.1.49972 WP_001295557.1.49987 WP_001295557.1.50006 WP_001295557.1.50008 WP_001295557.1.50036 WP_001295557.1.50056 WP_001295557.1.50058 WP_001295557.1.50078 WP_001295557.1.50098 WP_001295557.1.50113 WP_001295557.1.50119 WP_001295557.1.50136 WP_001295557.1.50146 WP_001295557.1.5017 WP_001295557.1.50182 WP_001295557.1.50187 WP_001295557.1.50191 WP_001295557.1.50196 WP_001295557.1.50230 WP_001295557.1.50258 WP_001295557.1.50262 WP_001295557.1.50266 WP_001295557.1.50269 WP_001295557.1.50270 WP_001295557.1.50273 WP_001295557.1.50278 WP_001295557.1.50329 WP_001295557.1.50353 WP_001295557.1.50361 WP_001295557.1.50366 WP_001295557.1.50381 WP_001295557.1.5040 WP_001295557.1.5041 WP_001295557.1.50412 WP_001295557.1.50418 WP_001295557.1.50446 WP_001295557.1.50452 WP_001295557.1.5046 WP_001295557.1.50539 WP_001295557.1.50548 WP_001295557.1.5056 WP_001295557.1.50564 WP_001295557.1.50579 WP_001295557.1.50585 WP_001295557.1.50586 WP_001295557.1.506 WP_001295557.1.50608 WP_001295557.1.5061 WP_001295557.1.50616 WP_001295557.1.50627 WP_001295557.1.5064 WP_001295557.1.5067 WP_001295557.1.50690 WP_001295557.1.50700 WP_001295557.1.50715 WP_001295557.1.50717 WP_001295557.1.50725 WP_001295557.1.50728 WP_001295557.1.50925 WP_001295557.1.50936 WP_001295557.1.50939 WP_001295557.1.50947 WP_001295557.1.5095 WP_001295557.1.50969 WP_001295557.1.50988 WP_001295557.1.50990 WP_001295557.1.50993 WP_001295557.1.50996 WP_001295557.1.51013 WP_001295557.1.51027 WP_001295557.1.51042 WP_001295557.1.51058 WP_001295557.1.51109 WP_001295557.1.51127 WP_001295557.1.51170 WP_001295557.1.51172 WP_001295557.1.51175 WP_001295557.1.51180 WP_001295557.1.51190 WP_001295557.1.51201 WP_001295557.1.51203 WP_001295557.1.51211 WP_001295557.1.5124 WP_001295557.1.51248 WP_001295557.1.51253 WP_001295557.1.51255 WP_001295557.1.51260 WP_001295557.1.51278 WP_001295557.1.5128 WP_001295557.1.51283 WP_001295557.1.51299 WP_001295557.1.51300 WP_001295557.1.51307 WP_001295557.1.51320 WP_001295557.1.51323 WP_001295557.1.51325 WP_001295557.1.51336 WP_001295557.1.51354 WP_001295557.1.51364 WP_001295557.1.51392 WP_001295557.1.51425 WP_001295557.1.51430 WP_001295557.1.51441 WP_001295557.1.5146 WP_001295557.1.51462 WP_001295557.1.51482 WP_001295557.1.51490 WP_001295557.1.51495 WP_001295557.1.51503 WP_001295557.1.51513 WP_001295557.1.51525 WP_001295557.1.5153 WP_001295557.1.51537 WP_001295557.1.51539 WP_001295557.1.51542 WP_001295557.1.51548 WP_001295557.1.51552 WP_001295557.1.5157 WP_001295557.1.5158 WP_001295557.1.51580 WP_001295557.1.51587 WP_001295557.1.51596 WP_001295557.1.51607 WP_001295557.1.51624 WP_001295557.1.51629 WP_001295557.1.51662 WP_001295557.1.51690 WP_001295557.1.51707 WP_001295557.1.51718 WP_001295557.1.5172 WP_001295557.1.51757 WP_001295557.1.51784 WP_001295557.1.518 WP_001295557.1.51804 WP_001295557.1.51837 WP_001295557.1.51869 WP_001295557.1.51873 WP_001295557.1.51881 WP_001295557.1.51896 WP_001295557.1.51899 WP_001295557.1.51906 WP_001295557.1.51944 WP_001295557.1.51949 WP_001295557.1.51968 WP_001295557.1.51988 WP_001295557.1.5199 WP_001295557.1.51999 WP_001295557.1.52002 WP_001295557.1.52011 WP_001295557.1.52020 WP_001295557.1.52044 WP_001295557.1.52048 WP_001295557.1.52062 WP_001295557.1.52076 WP_001295557.1.52098 WP_001295557.1.52111 WP_001295557.1.52126 WP_001295557.1.52127 WP_001295557.1.52135 WP_001295557.1.52137 WP_001295557.1.52171 WP_001295557.1.52186 WP_001295557.1.52200 WP_001295557.1.52211 WP_001295557.1.52214 WP_001295557.1.52225 WP_001295557.1.52230 WP_001295557.1.52236 WP_001295557.1.52240 WP_001295557.1.52243 WP_001295557.1.52249 WP_001295557.1.52258 WP_001295557.1.5227 WP_001295557.1.52271 WP_001295557.1.52272 WP_001295557.1.52299 WP_001295557.1.52304 WP_001295557.1.52305 WP_001295557.1.52313 WP_001295557.1.52324 WP_001295557.1.52328 WP_001295557.1.52363 WP_001295557.1.52378 WP_001295557.1.52399 WP_001295557.1.52413 WP_001295557.1.52419 WP_001295557.1.52421 WP_001295557.1.52492 WP_001295557.1.52524 WP_001295557.1.52542 WP_001295557.1.52544 WP_001295557.1.52554 WP_001295557.1.52558 WP_001295557.1.52567 WP_001295557.1.52568 WP_001295557.1.52601 WP_001295557.1.52612 WP_001295557.1.52631 WP_001295557.1.5265 WP_001295557.1.52662 WP_001295557.1.52691 WP_001295557.1.52704 WP_001295557.1.52710 WP_001295557.1.5272 WP_001295557.1.52735 WP_001295557.1.52755 WP_001295557.1.52771 WP_001295557.1.52774 WP_001295557.1.52777 WP_001295557.1.52781 WP_001295557.1.52801 WP_001295557.1.52844 WP_001295557.1.52846 WP_001295557.1.5285 WP_001295557.1.52853 WP_001295557.1.52855 WP_001295557.1.52881 WP_001295557.1.52895 WP_001295557.1.52908 WP_001295557.1.52913 WP_001295557.1.52942 WP_001295557.1.52945 WP_001295557.1.52995 WP_001295557.1.52996 WP_001295557.1.53012 WP_001295557.1.53020 WP_001295557.1.53027 WP_001295557.1.53099 WP_001295557.1.5310 WP_001295557.1.53110 WP_001295557.1.53123 WP_001295557.1.53155 WP_001295557.1.53162 WP_001295557.1.53186 WP_001295557.1.532 WP_001295557.1.5322 WP_001295557.1.53223 WP_001295557.1.53228 WP_001295557.1.53238 WP_001295557.1.53242 WP_001295557.1.53244 WP_001295557.1.53251 WP_001295557.1.53262 WP_001295557.1.53277 WP_001295557.1.53308 WP_001295557.1.53327 WP_001295557.1.53356 WP_001295557.1.53360 WP_001295557.1.53377 WP_001295557.1.53401 WP_001295557.1.53410 WP_001295557.1.53415 WP_001295557.1.53419 WP_001295557.1.5342 WP_001295557.1.53428 WP_001295557.1.53431 WP_001295557.1.53482 WP_001295557.1.53505 WP_001295557.1.5351 WP_001295557.1.53535 WP_001295557.1.53537 WP_001295557.1.53545 WP_001295557.1.53556 WP_001295557.1.53557 WP_001295557.1.53574 WP_001295557.1.53582 WP_001295557.1.53587 WP_001295557.1.53590 WP_001295557.1.53592 WP_001295557.1.53594 WP_001295557.1.53645 WP_001295557.1.53649 WP_001295557.1.53687 WP_001295557.1.53690 WP_001295557.1.53693 WP_001295557.1.53706 WP_001295557.1.53769 WP_001295557.1.53809 WP_001295557.1.53810 WP_001295557.1.53811 WP_001295557.1.53841 WP_001295557.1.53863 WP_001295557.1.53866 WP_001295557.1.53878 WP_001295557.1.53884 WP_001295557.1.5391 WP_001295557.1.5393 WP_001295557.1.53931 WP_001295557.1.53940 WP_001295557.1.5395 WP_001295557.1.53966 WP_001295557.1.53968 WP_001295557.1.53972 WP_001295557.1.53978 WP_001295557.1.53991 WP_001295557.1.53994 WP_001295557.1.54002 WP_001295557.1.54013 WP_001295557.1.54023 WP_001295557.1.54028 WP_001295557.1.54051 WP_001295557.1.54072 WP_001295557.1.54091 WP_001295557.1.54095 WP_001295557.1.54102 WP_001295557.1.54144 WP_001295557.1.54169 WP_001295557.1.54185 WP_001295557.1.54202 WP_001295557.1.54263 WP_001295557.1.54307 WP_001295557.1.54313 WP_001295557.1.54317 WP_001295557.1.54328 WP_001295557.1.54329 WP_001295557.1.5433 WP_001295557.1.54344 WP_001295557.1.54359 WP_001295557.1.54388 WP_001295557.1.54394 WP_001295557.1.5440 WP_001295557.1.54418 WP_001295557.1.54439 WP_001295557.1.54463 WP_001295557.1.54476 WP_001295557.1.54507 WP_001295557.1.54524 WP_001295557.1.54546 WP_001295557.1.54585 WP_001295557.1.54591 WP_001295557.1.5460 WP_001295557.1.54602 WP_001295557.1.54605 WP_001295557.1.5461 WP_001295557.1.54614 WP_001295557.1.54617 WP_001295557.1.54620 WP_001295557.1.54625 WP_001295557.1.54641 WP_001295557.1.54695 WP_001295557.1.5470 WP_001295557.1.54708 WP_001295557.1.54725 WP_001295557.1.54729 WP_001295557.1.54769 WP_001295557.1.5479 WP_001295557.1.54798 WP_001295557.1.54817 WP_001295557.1.54829 WP_001295557.1.5486 WP_001295557.1.54875 WP_001295557.1.54918 WP_001295557.1.54921 WP_001295557.1.54927 WP_001295557.1.54940 WP_001295557.1.54941 WP_001295557.1.54946 WP_001295557.1.54972 WP_001295557.1.54981 WP_001295557.1.54991 WP_001295557.1.54993 WP_001295557.1.55003 WP_001295557.1.55005 WP_001295557.1.55009 WP_001295557.1.55041 WP_001295557.1.55112 WP_001295557.1.55115 WP_001295557.1.55123 WP_001295557.1.55134 WP_001295557.1.55144 WP_001295557.1.55149 WP_001295557.1.55151 WP_001295557.1.55177 WP_001295557.1.55179 WP_001295557.1.55185 WP_001295557.1.55197 WP_001295557.1.5520 WP_001295557.1.55203 WP_001295557.1.55222 WP_001295557.1.55226 WP_001295557.1.55273 WP_001295557.1.55275 WP_001295557.1.55286 WP_001295557.1.55291 WP_001295557.1.55338 WP_001295557.1.55342 WP_001295557.1.55359 WP_001295557.1.55381 WP_001295557.1.55417 WP_001295557.1.55420 WP_001295557.1.55424 WP_001295557.1.55425 WP_001295557.1.5546 WP_001295557.1.55466 WP_001295557.1.55472 WP_001295557.1.55482 WP_001295557.1.55483 WP_001295557.1.55489 WP_001295557.1.55492 WP_001295557.1.55507 WP_001295557.1.55529 WP_001295557.1.55550 WP_001295557.1.55551 WP_001295557.1.55552 WP_001295557.1.55560 WP_001295557.1.55563 WP_001295557.1.55571 WP_001295557.1.55574 WP_001295557.1.55581 WP_001295557.1.55597 WP_001295557.1.55608 WP_001295557.1.5561 WP_001295557.1.55629 WP_001295557.1.5566 WP_001295557.1.55676 WP_001295557.1.5570 WP_001295557.1.55709 WP_001295557.1.55720 WP_001295557.1.55727 WP_001295557.1.55744 WP_001295557.1.55757 WP_001295557.1.55787 WP_001295557.1.55791 WP_001295557.1.55825 WP_001295557.1.55844 WP_001295557.1.55868 WP_001295557.1.55870 WP_001295557.1.55888 WP_001295557.1.55896 WP_001295557.1.55936 WP_001295557.1.55979 WP_001295557.1.55981 WP_001295557.1.55988 WP_001295557.1.55990 WP_001295557.1.56033 WP_001295557.1.56040 WP_001295557.1.56047 WP_001295557.1.561 WP_001295557.1.56101 WP_001295557.1.56139 WP_001295557.1.5614 WP_001295557.1.56142 WP_001295557.1.56149 WP_001295557.1.56151 WP_001295557.1.5616 WP_001295557.1.56164 WP_001295557.1.56169 WP_001295557.1.56177 WP_001295557.1.56193 WP_001295557.1.56197 WP_001295557.1.562 WP_001295557.1.56278 WP_001295557.1.56285 WP_001295557.1.56302 WP_001295557.1.5632 WP_001295557.1.56338 WP_001295557.1.56345 WP_001295557.1.56371 WP_001295557.1.56388 WP_001295557.1.56390 WP_001295557.1.56402 WP_001295557.1.56436 WP_001295557.1.56446 WP_001295557.1.56457 WP_001295557.1.5646 WP_001295557.1.56469 WP_001295557.1.5649 WP_001295557.1.56501 WP_001295557.1.56502 WP_001295557.1.56513 WP_001295557.1.56523 WP_001295557.1.56528 WP_001295557.1.56543 WP_001295557.1.56573 WP_001295557.1.56586 WP_001295557.1.56650 WP_001295557.1.56665 WP_001295557.1.56680 WP_001295557.1.56689 WP_001295557.1.5670 WP_001295557.1.56713 WP_001295557.1.56714 WP_001295557.1.56742 WP_001295557.1.56776 WP_001295557.1.56777 WP_001295557.1.56786 WP_001295557.1.56787 WP_001295557.1.56789 WP_001295557.1.56799 WP_001295557.1.56821 WP_001295557.1.56835 WP_001295557.1.56846 WP_001295557.1.5685 WP_001295557.1.56871 WP_001295557.1.56882 WP_001295557.1.56908 WP_001295557.1.56932 WP_001295557.1.56933 WP_001295557.1.56934 WP_001295557.1.56936 WP_001295557.1.56937 WP_001295557.1.56951 WP_001295557.1.56978 WP_001295557.1.56980 WP_001295557.1.56992 WP_001295557.1.57011 WP_001295557.1.57045 WP_001295557.1.57051 WP_001295557.1.57068 WP_001295557.1.57072 WP_001295557.1.57079 WP_001295557.1.57086 WP_001295557.1.57100 WP_001295557.1.57124 WP_001295557.1.57159 WP_001295557.1.57181 WP_001295557.1.57185 WP_001295557.1.57202 WP_001295557.1.57213 WP_001295557.1.57222 WP_001295557.1.57254 WP_001295557.1.57266 WP_001295557.1.57269 WP_001295557.1.57278 WP_001295557.1.57281 WP_001295557.1.57319 WP_001295557.1.57349 WP_001295557.1.57386 WP_001295557.1.57401 WP_001295557.1.57403 WP_001295557.1.57410 WP_001295557.1.57414 WP_001295557.1.5742 WP_001295557.1.57432 WP_001295557.1.57451 WP_001295557.1.57487 WP_001295557.1.57492 WP_001295557.1.57517 WP_001295557.1.57538 WP_001295557.1.57539 WP_001295557.1.5755 WP_001295557.1.57550 WP_001295557.1.57558 WP_001295557.1.57574 WP_001295557.1.57588 WP_001295557.1.57628 WP_001295557.1.57629 WP_001295557.1.57634 WP_001295557.1.57638 WP_001295557.1.57659 WP_001295557.1.57663 WP_001295557.1.57669 WP_001295557.1.57738 WP_001295557.1.57812 WP_001295557.1.57846 WP_001295557.1.57851 WP_001295557.1.57854 WP_001295557.1.5786 WP_001295557.1.5787 WP_001295557.1.57898 WP_001295557.1.57903 WP_001295557.1.57904 WP_001295557.1.57951 WP_001295557.1.57975 WP_001295557.1.57982 WP_001295557.1.58001 WP_001295557.1.58009 WP_001295557.1.58022 WP_001295557.1.58045 WP_001295557.1.58060 WP_001295557.1.58080 WP_001295557.1.58092 WP_001295557.1.58094 WP_001295557.1.58097 WP_001295557.1.5810 WP_001295557.1.58107 WP_001295557.1.5812 WP_001295557.1.58143 WP_001295557.1.58146 WP_001295557.1.58163 WP_001295557.1.58172 WP_001295557.1.58206 WP_001295557.1.58226 WP_001295557.1.58232 WP_001295557.1.58244 WP_001295557.1.58248 WP_001295557.1.58267 WP_001295557.1.58292 WP_001295557.1.58316 WP_001295557.1.58336 WP_001295557.1.58340 WP_001295557.1.58368 WP_001295557.1.58371 WP_001295557.1.58384 WP_001295557.1.58401 WP_001295557.1.58408 WP_001295557.1.58414 WP_001295557.1.5842 WP_001295557.1.58420 WP_001295557.1.58424 WP_001295557.1.58429 WP_001295557.1.58440 WP_001295557.1.58444 WP_001295557.1.58445 WP_001295557.1.58449 WP_001295557.1.58459 WP_001295557.1.58475 WP_001295557.1.58484 WP_001295557.1.58493 WP_001295557.1.58496 WP_001295557.1.585 WP_001295557.1.58507 WP_001295557.1.58514 WP_001295557.1.58528 WP_001295557.1.58547 WP_001295557.1.58552 WP_001295557.1.58572 WP_001295557.1.58582 WP_001295557.1.58609 WP_001295557.1.58617 WP_001295557.1.58622 WP_001295557.1.58657 WP_001295557.1.58680 WP_001295557.1.58692 WP_001295557.1.58705 WP_001295557.1.58737 WP_001295557.1.58837 WP_001295557.1.58867 WP_001295557.1.58870 WP_001295557.1.58901 WP_001295557.1.58940 WP_001295557.1.58942 WP_001295557.1.58951 WP_001295557.1.58958 WP_001295557.1.58976 WP_001295557.1.58977 WP_001295557.1.58983 WP_001295557.1.59024 WP_001295557.1.59026 WP_001295557.1.59035 WP_001295557.1.59055 WP_001295557.1.5906 WP_001295557.1.59073 WP_001295557.1.59083 WP_001295557.1.59119 WP_001295557.1.59174 WP_001295557.1.59190 WP_001295557.1.59218 WP_001295557.1.59263 WP_001295557.1.5927 WP_001295557.1.59280 WP_001295557.1.59291 WP_001295557.1.59292 WP_001295557.1.59293 WP_001295557.1.59302 WP_001295557.1.59306 WP_001295557.1.59359 WP_001295557.1.59395 WP_001295557.1.59396 WP_001295557.1.59407 WP_001295557.1.59409 WP_001295557.1.59413 WP_001295557.1.5942 WP_001295557.1.59423 WP_001295557.1.59425 WP_001295557.1.59426 WP_001295557.1.59434 WP_001295557.1.59513 WP_001295557.1.59533 WP_001295557.1.59553 WP_001295557.1.59572 WP_001295557.1.59577 WP_001295557.1.59579 WP_001295557.1.59590 WP_001295557.1.59611 WP_001295557.1.59613 WP_001295557.1.59615 WP_001295557.1.59621 WP_001295557.1.5963 WP_001295557.1.59638 WP_001295557.1.59660 WP_001295557.1.59689 WP_001295557.1.59699 WP_001295557.1.597 WP_001295557.1.59714 WP_001295557.1.59717 WP_001295557.1.59730 WP_001295557.1.59737 WP_001295557.1.59745 WP_001295557.1.59756 WP_001295557.1.59781 WP_001295557.1.59782 WP_001295557.1.59788 WP_001295557.1.59791 WP_001295557.1.59793 WP_001295557.1.59823 WP_001295557.1.59836 WP_001295557.1.59853 WP_001295557.1.59855 WP_001295557.1.59858 WP_001295557.1.59877 WP_001295557.1.59894 WP_001295557.1.5990 WP_001295557.1.59900 WP_001295557.1.59912 WP_001295557.1.59914 WP_001295557.1.59931 WP_001295557.1.59932 WP_001295557.1.59980 WP_001295557.1.59981 WP_001295557.1.59989 WP_001295557.1.59998 WP_001295557.1.60005 WP_001295557.1.6002 WP_001295557.1.60023 WP_001295557.1.60031 WP_001295557.1.60048 WP_001295557.1.60067 WP_001295557.1.60070 WP_001295557.1.60095 WP_001295557.1.60096 WP_001295557.1.60110 WP_001295557.1.6013 WP_001295557.1.60133 WP_001295557.1.60151 WP_001295557.1.60186 WP_001295557.1.6022 WP_001295557.1.60228 WP_001295557.1.60235 WP_001295557.1.60246 WP_001295557.1.60325 WP_001295557.1.60337 WP_001295557.1.60350 WP_001295557.1.60373 WP_001295557.1.60387 WP_001295557.1.60411 WP_001295557.1.60436 WP_001295557.1.60443 WP_001295557.1.60453 WP_001295557.1.60457 WP_001295557.1.60477 WP_001295557.1.60491 WP_001295557.1.60498 WP_001295557.1.60544 WP_001295557.1.60550 WP_001295557.1.60555 WP_001295557.1.60559 WP_001295557.1.60567 WP_001295557.1.60570 WP_001295557.1.60576 WP_001295557.1.6059 WP_001295557.1.60591 WP_001295557.1.60599 WP_001295557.1.60606 WP_001295557.1.6061 WP_001295557.1.60614 WP_001295557.1.60630 WP_001295557.1.6064 WP_001295557.1.60644 WP_001295557.1.60654 WP_001295557.1.6066 WP_001295557.1.60671 WP_001295557.1.60684 WP_001295557.1.60698 WP_001295557.1.60717 WP_001295557.1.60732 WP_001295557.1.60764 WP_001295557.1.60771 WP_001295557.1.60805 WP_001295557.1.60816 WP_001295557.1.60826 WP_001295557.1.60832 WP_001295557.1.60835 WP_001295557.1.60847 WP_001295557.1.60895 WP_001295557.1.60901 WP_001295557.1.60921 WP_001295557.1.60925 WP_001295557.1.60927 WP_001295557.1.60935 WP_001295557.1.6094 WP_001295557.1.60974 WP_001295557.1.61005 WP_001295557.1.61008 WP_001295557.1.61035 WP_001295557.1.61058 WP_001295557.1.6106 WP_001295557.1.61096 WP_001295557.1.61097 WP_001295557.1.6110 WP_001295557.1.61102 WP_001295557.1.61112 WP_001295557.1.61121 WP_001295557.1.61148 WP_001295557.1.61170 WP_001295557.1.61174 WP_001295557.1.61175 WP_001295557.1.61181 WP_001295557.1.61183 WP_001295557.1.61223 WP_001295557.1.61225 WP_001295557.1.61241 WP_001295557.1.61245 WP_001295557.1.61268 WP_001295557.1.61284 WP_001295557.1.61292 WP_001295557.1.613 WP_001295557.1.61360 WP_001295557.1.61362 WP_001295557.1.61373 WP_001295557.1.6138 WP_001295557.1.61398 WP_001295557.1.61442 WP_001295557.1.61445 WP_001295557.1.61480 WP_001295557.1.61496 WP_001295557.1.61505 WP_001295557.1.61512 WP_001295557.1.61517 WP_001295557.1.61524 WP_001295557.1.61551 WP_001295557.1.61608 WP_001295557.1.61612 WP_001295557.1.61617 WP_001295557.1.61636 WP_001295557.1.61643 WP_001295557.1.61663 WP_001295557.1.61703 WP_001295557.1.61718 WP_001295557.1.61739 WP_001295557.1.61758 WP_001295557.1.61770 WP_001295557.1.61772 WP_001295557.1.61779 WP_001295557.1.61789 WP_001295557.1.61806 WP_001295557.1.61822 WP_001295557.1.61835 WP_001295557.1.61853 WP_001295557.1.61858 WP_001295557.1.61893 WP_001295557.1.61926 WP_001295557.1.61939 WP_001295557.1.61948 WP_001295557.1.61949 WP_001295557.1.61955 WP_001295557.1.61957 WP_001295557.1.61966 WP_001295557.1.62038 WP_001295557.1.62041 WP_001295557.1.62043 WP_001295557.1.62099 WP_001295557.1.62102 WP_001295557.1.6212 WP_001295557.1.62157 WP_001295557.1.62207 WP_001295557.1.62236 WP_001295557.1.62262 WP_001295557.1.62264 WP_001295557.1.62266 WP_001295557.1.62273 WP_001295557.1.62290 WP_001295557.1.62296 WP_001295557.1.62303 WP_001295557.1.62322 WP_001295557.1.62337 WP_001295557.1.62348 WP_001295557.1.62358 WP_001295557.1.62424 WP_001295557.1.62447 WP_001295557.1.6245 WP_001295557.1.62454 WP_001295557.1.62460 WP_001295557.1.62481 WP_001295557.1.62503 WP_001295557.1.62507 WP_001295557.1.62513 WP_001295557.1.62514 WP_001295557.1.62529 WP_001295557.1.62555 WP_001295557.1.62612 WP_001295557.1.62642 WP_001295557.1.62646 WP_001295557.1.62668 WP_001295557.1.62681 WP_001295557.1.62714 WP_001295557.1.62735 WP_001295557.1.62750 WP_001295557.1.62762 WP_001295557.1.62780 WP_001295557.1.62784 WP_001295557.1.62788 WP_001295557.1.62802 WP_001295557.1.62812 WP_001295557.1.62818 WP_001295557.1.62819 WP_001295557.1.6282 WP_001295557.1.62840 WP_001295557.1.62843 WP_001295557.1.62850 WP_001295557.1.62851 WP_001295557.1.62866 WP_001295557.1.62885 WP_001295557.1.62919 WP_001295557.1.6293 WP_001295557.1.62931 WP_001295557.1.62951 WP_001295557.1.62959 WP_001295557.1.62989 WP_001295557.1.6299 WP_001295557.1.62992 WP_001295557.1.63023 WP_001295557.1.63078 WP_001295557.1.63167 WP_001295557.1.63177 WP_001295557.1.63189 WP_001295557.1.6323 WP_001295557.1.63246 WP_001295557.1.63271 WP_001295557.1.63285 WP_001295557.1.63287 WP_001295557.1.63305 WP_001295557.1.6334 WP_001295557.1.6337 WP_001295557.1.63370 WP_001295557.1.63374 WP_001295557.1.63393 WP_001295557.1.63433 WP_001295557.1.63435 WP_001295557.1.63437 WP_001295557.1.63453 WP_001295557.1.63466 WP_001295557.1.63467 WP_001295557.1.63478 WP_001295557.1.6348 WP_001295557.1.63484 WP_001295557.1.63487 WP_001295557.1.63491 WP_001295557.1.63496 WP_001295557.1.63536 WP_001295557.1.63556 WP_001295557.1.63576 WP_001295557.1.63602 WP_001295557.1.63666 WP_001295557.1.63679 WP_001295557.1.63683 WP_001295557.1.63703 WP_001295557.1.63721 WP_001295557.1.63746 WP_001295557.1.63800 WP_001295557.1.63810 WP_001295557.1.63814 WP_001295557.1.63821 WP_001295557.1.63871 WP_001295557.1.63944 WP_001295557.1.63964 WP_001295557.1.63990 WP_001295557.1.64008 WP_001295557.1.64014 WP_001295557.1.64030 WP_001295557.1.64040 WP_001295557.1.64050 WP_001295557.1.64053 WP_001295557.1.64074 WP_001295557.1.64080 WP_001295557.1.64110 WP_001295557.1.64138 WP_001295557.1.64150 WP_001295557.1.6416 WP_001295557.1.64175 WP_001295557.1.64190 WP_001295557.1.64193 WP_001295557.1.64280 WP_001295557.1.64285 WP_001295557.1.64286 WP_001295557.1.6431 WP_001295557.1.64312 WP_001295557.1.64321 WP_001295557.1.64330 WP_001295557.1.64337 WP_001295557.1.64355 WP_001295557.1.64356 WP_001295557.1.64380 WP_001295557.1.64391 WP_001295557.1.6441 WP_001295557.1.64417 WP_001295557.1.64437 WP_001295557.1.64438 WP_001295557.1.6444 WP_001295557.1.64448 WP_001295557.1.64458 WP_001295557.1.6446 WP_001295557.1.64519 WP_001295557.1.64520 WP_001295557.1.64528 WP_001295557.1.64540 WP_001295557.1.64547 WP_001295557.1.64563 WP_001295557.1.64634 WP_001295557.1.64657 WP_001295557.1.64670 WP_001295557.1.6469 WP_001295557.1.64693 WP_001295557.1.64707 WP_001295557.1.64712 WP_001295557.1.64746 WP_001295557.1.64749 WP_001295557.1.64784 WP_001295557.1.64789 WP_001295557.1.64821 WP_001295557.1.64840 WP_001295557.1.64866 WP_001295557.1.64875 WP_001295557.1.64881 WP_001295557.1.64895 WP_001295557.1.64912 WP_001295557.1.64939 WP_001295557.1.64970 WP_001295557.1.6499 WP_001295557.1.64990 WP_001295557.1.65023 WP_001295557.1.65040 WP_001295557.1.65056 WP_001295557.1.65097 WP_001295557.1.651 WP_001295557.1.6511 WP_001295557.1.65110 WP_001295557.1.65114 WP_001295557.1.65116 WP_001295557.1.65122 WP_001295557.1.65135 WP_001295557.1.65151 WP_001295557.1.65155 WP_001295557.1.6516 WP_001295557.1.65179 WP_001295557.1.65192 WP_001295557.1.65206 WP_001295557.1.65240 WP_001295557.1.65256 WP_001295557.1.65271 WP_001295557.1.65286 WP_001295557.1.65296 WP_001295557.1.65306 WP_001295557.1.65353 WP_001295557.1.65355 WP_001295557.1.65364 WP_001295557.1.65366 WP_001295557.1.6537 WP_001295557.1.65370 WP_001295557.1.654 WP_001295557.1.65405 WP_001295557.1.65408 WP_001295557.1.65413 WP_001295557.1.65415 WP_001295557.1.65456 WP_001295557.1.6553 WP_001295557.1.65531 WP_001295557.1.65565 WP_001295557.1.65571 WP_001295557.1.65581 WP_001295557.1.65596 WP_001295557.1.65606 WP_001295557.1.65667 WP_001295557.1.65672 WP_001295557.1.65677 WP_001295557.1.65714 WP_001295557.1.65749 WP_001295557.1.6576 WP_001295557.1.65762 WP_001295557.1.65834 WP_001295557.1.65912 WP_001295557.1.65954 WP_001295557.1.65961 WP_001295557.1.65962 WP_001295557.1.6599 WP_001295557.1.65991 WP_001295557.1.66001 WP_001295557.1.66007 WP_001295557.1.66016 WP_001295557.1.66017 WP_001295557.1.6604 WP_001295557.1.66044 WP_001295557.1.66050 WP_001295557.1.66071 WP_001295557.1.6609 WP_001295557.1.66094 WP_001295557.1.66102 WP_001295557.1.66104 WP_001295557.1.66105 WP_001295557.1.66121 WP_001295557.1.66127 WP_001295557.1.66161 WP_001295557.1.6618 WP_001295557.1.66181 WP_001295557.1.66187 WP_001295557.1.66197 WP_001295557.1.6622 WP_001295557.1.66251 WP_001295557.1.66255 WP_001295557.1.66264 WP_001295557.1.66280 WP_001295557.1.66288 WP_001295557.1.66290 WP_001295557.1.66295 WP_001295557.1.66327 WP_001295557.1.66335 WP_001295557.1.6635 WP_001295557.1.66376 WP_001295557.1.66387 WP_001295557.1.66389 WP_001295557.1.66392 WP_001295557.1.66395 WP_001295557.1.66412 WP_001295557.1.66421 WP_001295557.1.66432 WP_001295557.1.6645 WP_001295557.1.66501 WP_001295557.1.66511 WP_001295557.1.66523 WP_001295557.1.6654 WP_001295557.1.66550 WP_001295557.1.66559 WP_001295557.1.66579 WP_001295557.1.66624 WP_001295557.1.66644 WP_001295557.1.6665 WP_001295557.1.66667 WP_001295557.1.66668 WP_001295557.1.66700 WP_001295557.1.66708 WP_001295557.1.66719 WP_001295557.1.66727 WP_001295557.1.66751 WP_001295557.1.66758 WP_001295557.1.6676 WP_001295557.1.66783 WP_001295557.1.66787 WP_001295557.1.66791 WP_001295557.1.66795 WP_001295557.1.66796 WP_001295557.1.66849 WP_001295557.1.66926 WP_001295557.1.66933 WP_001295557.1.66948 WP_001295557.1.66975 WP_001295557.1.6698 WP_001295557.1.66984 WP_001295557.1.67018 WP_001295557.1.67021 WP_001295557.1.67022 WP_001295557.1.67026 WP_001295557.1.67029 WP_001295557.1.67055 WP_001295557.1.6706 WP_001295557.1.67102 WP_001295557.1.67120 WP_001295557.1.67137 WP_001295557.1.67149 WP_001295557.1.67153 WP_001295557.1.67158 WP_001295557.1.67174 WP_001295557.1.67193 WP_001295557.1.67194 WP_001295557.1.67200 WP_001295557.1.67209 WP_001295557.1.67210 WP_001295557.1.6723 WP_001295557.1.67258 WP_001295557.1.67272 WP_001295557.1.67284 WP_001295557.1.67293 WP_001295557.1.6735 WP_001295557.1.67373 WP_001295557.1.67383 WP_001295557.1.67415 WP_001295557.1.67427 WP_001295557.1.67451 WP_001295557.1.67452 WP_001295557.1.67454 WP_001295557.1.67462 WP_001295557.1.67464 WP_001295557.1.67467 WP_001295557.1.67468 WP_001295557.1.67495 WP_001295557.1.67522 WP_001295557.1.67538 WP_001295557.1.67549 WP_001295557.1.67553 WP_001295557.1.67581 WP_001295557.1.67590 WP_001295557.1.67606 WP_001295557.1.67660 WP_001295557.1.67663 WP_001295557.1.67690 WP_001295557.1.67701 WP_001295557.1.67704 WP_001295557.1.67724 WP_001295557.1.67732 WP_001295557.1.67737 WP_001295557.1.67758 WP_001295557.1.67786 WP_001295557.1.67787 WP_001295557.1.67788 WP_001295557.1.678 WP_001295557.1.67810 WP_001295557.1.67841 WP_001295557.1.67853 WP_001295557.1.67891 WP_001295557.1.67894 WP_001295557.1.67901 WP_001295557.1.6793 WP_001295557.1.67938 WP_001295557.1.67971 WP_001295557.1.67975 WP_001295557.1.67984 WP_001295557.1.67990 WP_001295557.1.67992 WP_001295557.1.67999 WP_001295557.1.68011 WP_001295557.1.68012 WP_001295557.1.6802 WP_001295557.1.68025 WP_001295557.1.6803 WP_001295557.1.68039 WP_001295557.1.68053 WP_001295557.1.68058 WP_001295557.1.68059 WP_001295557.1.68063 WP_001295557.1.68067 WP_001295557.1.68069 WP_001295557.1.68070 WP_001295557.1.68071 WP_001295557.1.68079 WP_001295557.1.6810 WP_001295557.1.68108 WP_001295557.1.68126 WP_001295557.1.68138 WP_001295557.1.6814 WP_001295557.1.68145 WP_001295557.1.68157 WP_001295557.1.68170 WP_001295557.1.68175 WP_001295557.1.68177 WP_001295557.1.682 WP_001295557.1.68215 WP_001295557.1.68231 WP_001295557.1.68255 WP_001295557.1.68271 WP_001295557.1.68278 WP_001295557.1.68279 WP_001295557.1.68281 WP_001295557.1.68283 WP_001295557.1.68292 WP_001295557.1.68300 WP_001295557.1.68336 WP_001295557.1.68341 WP_001295557.1.68347 WP_001295557.1.68362 WP_001295557.1.68369 WP_001295557.1.68372 WP_001295557.1.68395 WP_001295557.1.68396 WP_001295557.1.68441 WP_001295557.1.68442 WP_001295557.1.68482 WP_001295557.1.68490 WP_001295557.1.68524 WP_001295557.1.68534 WP_001295557.1.68566 WP_001295557.1.68572 WP_001295557.1.68584 WP_001295557.1.6859 WP_001295557.1.68598 WP_001295557.1.6860 WP_001295557.1.68609 WP_001295557.1.68630 WP_001295557.1.68632 WP_001295557.1.68635 WP_001295557.1.68679 WP_001295557.1.68695 WP_001295557.1.68697 WP_001295557.1.68701 WP_001295557.1.68711 WP_001295557.1.68731 WP_001295557.1.68735 WP_001295557.1.68750 WP_001295557.1.68751 WP_001295557.1.68752 WP_001295557.1.6877 WP_001295557.1.68793 WP_001295557.1.68795 WP_001295557.1.68797 WP_001295557.1.68801 WP_001295557.1.68838 WP_001295557.1.68847 WP_001295557.1.68865 WP_001295557.1.68873 WP_001295557.1.68877 WP_001295557.1.68880 WP_001295557.1.68911 WP_001295557.1.68915 WP_001295557.1.68942 WP_001295557.1.68952 WP_001295557.1.68956 WP_001295557.1.68961 WP_001295557.1.68989 WP_001295557.1.68995 WP_001295557.1.69033 WP_001295557.1.69039 WP_001295557.1.69098 WP_001295557.1.69126 WP_001295557.1.69127 WP_001295557.1.69144 WP_001295557.1.69158 WP_001295557.1.6916 WP_001295557.1.69160 WP_001295557.1.6919 WP_001295557.1.69192 WP_001295557.1.6921 WP_001295557.1.6923 WP_001295557.1.69247 WP_001295557.1.69258 WP_001295557.1.69261 WP_001295557.1.6929 WP_001295557.1.69303 WP_001295557.1.69305 WP_001295557.1.69327 WP_001295557.1.69341 WP_001295557.1.69390 WP_001295557.1.694 WP_001295557.1.69438 WP_001295557.1.69441 WP_001295557.1.6945 WP_001295557.1.69472 WP_001295557.1.69473 WP_001295557.1.69502 WP_001295557.1.69506 WP_001295557.1.69537 WP_001295557.1.69551 WP_001295557.1.69569 WP_001295557.1.69583 WP_001295557.1.69589 WP_001295557.1.69593 WP_001295557.1.69596 WP_001295557.1.69605 WP_001295557.1.69643 WP_001295557.1.69649 WP_001295557.1.69655 WP_001295557.1.69716 WP_001295557.1.69730 WP_001295557.1.69735 WP_001295557.1.69786 WP_001295557.1.69803 WP_001295557.1.69831 WP_001295557.1.69872 WP_001295557.1.69887 WP_001295557.1.6993 WP_001295557.1.69972 WP_001295557.1.69979 WP_001295557.1.69999 WP_001295557.1.7001 WP_001295557.1.70063 WP_001295557.1.70081 WP_001295557.1.7013 WP_001295557.1.70149 WP_001295557.1.70190 WP_001295557.1.70200 WP_001295557.1.70213 WP_001295557.1.70256 WP_001295557.1.70300 WP_001295557.1.70337 WP_001295557.1.70357 WP_001295557.1.70370 WP_001295557.1.70386 WP_001295557.1.70407 WP_001295557.1.70408 WP_001295557.1.70477 WP_001295557.1.70492 WP_001295557.1.7050 WP_001295557.1.70509 WP_001295557.1.7052 WP_001295557.1.70530 WP_001295557.1.70563 WP_001295557.1.70578 WP_001295557.1.70582 WP_001295557.1.70592 WP_001295557.1.70600 WP_001295557.1.70619 WP_001295557.1.70628 WP_001295557.1.70655 WP_001295557.1.70656 WP_001295557.1.70686 WP_001295557.1.70694 WP_001295557.1.70698 WP_001295557.1.70705 WP_001295557.1.70728 WP_001295557.1.70747 WP_001295557.1.70748 WP_001295557.1.70767 WP_001295557.1.70794 WP_001295557.1.70801 WP_001295557.1.70803 WP_001295557.1.70880 WP_001295557.1.70896 WP_001295557.1.7090 WP_001295557.1.70900 WP_001295557.1.70952 WP_001295557.1.70967 WP_001295557.1.7102 WP_001295557.1.71024 WP_001295557.1.71037 WP_001295557.1.71042 WP_001295557.1.71062 WP_001295557.1.71109 WP_001295557.1.71113 WP_001295557.1.71134 WP_001295557.1.71139 WP_001295557.1.71144 WP_001295557.1.71147 WP_001295557.1.71149 WP_001295557.1.71159 WP_001295557.1.71170 WP_001295557.1.71176 WP_001295557.1.71192 WP_001295557.1.71199 WP_001295557.1.7121 WP_001295557.1.71221 WP_001295557.1.71223 WP_001295557.1.71229 WP_001295557.1.71264 WP_001295557.1.71272 WP_001295557.1.71273 WP_001295557.1.71275 WP_001295557.1.71285 WP_001295557.1.71294 WP_001295557.1.71311 WP_001295557.1.71312 WP_001295557.1.71315 WP_001295557.1.71323 WP_001295557.1.71327 WP_001295557.1.71339 WP_001295557.1.71354 WP_001295557.1.71397 WP_001295557.1.71403 WP_001295557.1.71405 WP_001295557.1.71409 WP_001295557.1.7147 WP_001295557.1.71480 WP_001295557.1.71522 WP_001295557.1.71537 WP_001295557.1.71538 WP_001295557.1.71540 WP_001295557.1.71560 WP_001295557.1.71562 WP_001295557.1.71563 WP_001295557.1.71603 WP_001295557.1.71607 WP_001295557.1.71632 WP_001295557.1.71690 WP_001295557.1.71695 WP_001295557.1.71712 WP_001295557.1.71732 WP_001295557.1.71757 WP_001295557.1.71767 WP_001295557.1.71783 WP_001295557.1.71830 WP_001295557.1.71832 WP_001295557.1.71837 WP_001295557.1.71855 WP_001295557.1.71856 WP_001295557.1.71874 WP_001295557.1.71912 WP_001295557.1.7192 WP_001295557.1.71922 WP_001295557.1.71938 WP_001295557.1.71940 WP_001295557.1.71944 WP_001295557.1.71945 WP_001295557.1.71972 WP_001295557.1.71975 WP_001295557.1.71987 WP_001295557.1.71993 WP_001295557.1.71995 WP_001295557.1.72013 WP_001295557.1.72028 WP_001295557.1.72033 WP_001295557.1.72048 WP_001295557.1.72053 WP_001295557.1.72054 WP_001295557.1.72066 WP_001295557.1.72090 WP_001295557.1.72098 WP_001295557.1.7210 WP_001295557.1.72120 WP_001295557.1.72126 WP_001295557.1.72153 WP_001295557.1.72155 WP_001295557.1.72157 WP_001295557.1.72184 WP_001295557.1.72208 WP_001295557.1.72212 WP_001295557.1.72237 WP_001295557.1.72240 WP_001295557.1.7225 WP_001295557.1.72258 WP_001295557.1.72261 WP_001295557.1.72262 WP_001295557.1.72270 WP_001295557.1.72279 WP_001295557.1.72290 WP_001295557.1.72293 WP_001295557.1.72298 WP_001295557.1.72337 WP_001295557.1.72352 WP_001295557.1.72359 WP_001295557.1.72362 WP_001295557.1.72388 WP_001295557.1.72391 WP_001295557.1.72392 WP_001295557.1.72397 WP_001295557.1.72414 WP_001295557.1.72431 WP_001295557.1.72436 WP_001295557.1.72469 WP_001295557.1.72485 WP_001295557.1.72493 WP_001295557.1.72507 WP_001295557.1.72521 WP_001295557.1.72522 WP_001295557.1.72535 WP_001295557.1.72537 WP_001295557.1.72544 WP_001295557.1.72551 WP_001295557.1.72574 WP_001295557.1.72588 WP_001295557.1.72593 WP_001295557.1.72596 WP_001295557.1.72606 WP_001295557.1.72608 WP_001295557.1.72615 WP_001295557.1.72616 WP_001295557.1.72619 WP_001295557.1.72643 WP_001295557.1.72651 WP_001295557.1.72652 WP_001295557.1.72663 WP_001295557.1.72694 WP_001295557.1.72695 WP_001295557.1.72700 WP_001295557.1.72706 WP_001295557.1.72725 WP_001295557.1.72729 WP_001295557.1.72738 WP_001295557.1.72745 WP_001295557.1.72751 WP_001295557.1.72758 WP_001295557.1.72764 WP_001295557.1.7277 WP_001295557.1.72778 WP_001295557.1.72804 WP_001295557.1.72806 WP_001295557.1.7281 WP_001295557.1.72837 WP_001295557.1.72857 WP_001295557.1.72858 WP_001295557.1.72860 WP_001295557.1.72869 WP_001295557.1.72893 WP_001295557.1.72910 WP_001295557.1.72947 WP_001295557.1.72950 WP_001295557.1.72956 WP_001295557.1.72962 WP_001295557.1.72998 WP_001295557.1.73000 WP_001295557.1.73015 WP_001295557.1.73032 WP_001295557.1.73061 WP_001295557.1.7307 WP_001295557.1.73072 WP_001295557.1.73075 WP_001295557.1.73085 WP_001295557.1.7309 WP_001295557.1.73129 WP_001295557.1.73193 WP_001295557.1.73197 WP_001295557.1.73215 WP_001295557.1.73217 WP_001295557.1.73230 WP_001295557.1.73239 WP_001295557.1.73249 WP_001295557.1.73251 WP_001295557.1.73257 WP_001295557.1.73259 WP_001295557.1.73277 WP_001295557.1.73278 WP_001295557.1.73291 WP_001295557.1.73292 WP_001295557.1.73295 WP_001295557.1.73326 WP_001295557.1.73340 WP_001295557.1.73344 WP_001295557.1.73349 WP_001295557.1.73385 WP_001295557.1.73393 WP_001295557.1.73430 WP_001295557.1.7345 WP_001295557.1.73468 WP_001295557.1.73486 WP_001295557.1.7349 WP_001295557.1.73498 WP_001295557.1.73524 WP_001295557.1.73565 WP_001295557.1.73572 WP_001295557.1.73592 WP_001295557.1.73604 WP_001295557.1.73631 WP_001295557.1.73652 WP_001295557.1.73663 WP_001295557.1.73700 WP_001295557.1.73709 WP_001295557.1.73717 WP_001295557.1.73743 WP_001295557.1.73748 WP_001295557.1.7376 WP_001295557.1.73783 WP_001295557.1.73797 WP_001295557.1.73807 WP_001295557.1.73811 WP_001295557.1.73827 WP_001295557.1.73835 WP_001295557.1.73843 WP_001295557.1.73844 WP_001295557.1.73846 WP_001295557.1.73859 WP_001295557.1.73882 WP_001295557.1.73897 WP_001295557.1.73908 WP_001295557.1.73942 WP_001295557.1.73980 WP_001295557.1.73992 WP_001295557.1.73995 WP_001295557.1.73996 WP_001295557.1.74046 WP_001295557.1.74051 WP_001295557.1.74053 WP_001295557.1.7407 WP_001295557.1.7411 WP_001295557.1.7413 WP_001295557.1.74156 WP_001295557.1.74184 WP_001295557.1.74185 WP_001295557.1.74213 WP_001295557.1.74223 WP_001295557.1.7424 WP_001295557.1.74243 WP_001295557.1.7425 WP_001295557.1.74251 WP_001295557.1.74267 WP_001295557.1.74294 WP_001295557.1.74309 WP_001295557.1.74358 WP_001295557.1.74365 WP_001295557.1.74367 WP_001295557.1.744 WP_001295557.1.74423 WP_001295557.1.74431 WP_001295557.1.74444 WP_001295557.1.74445 WP_001295557.1.74465 WP_001295557.1.74478 WP_001295557.1.74491 WP_001295557.1.74501 WP_001295557.1.74513 WP_001295557.1.74520 WP_001295557.1.74528 WP_001295557.1.74532 WP_001295557.1.74549 WP_001295557.1.74574 WP_001295557.1.7461 WP_001295557.1.74611 WP_001295557.1.74623 WP_001295557.1.74624 WP_001295557.1.74625 WP_001295557.1.74631 WP_001295557.1.74652 WP_001295557.1.74670 WP_001295557.1.74687 WP_001295557.1.74688 WP_001295557.1.74691 WP_001295557.1.7471 WP_001295557.1.74713 WP_001295557.1.74716 WP_001295557.1.74720 WP_001295557.1.74735 WP_001295557.1.7475 WP_001295557.1.74752 WP_001295557.1.74765 WP_001295557.1.74767 WP_001295557.1.7478 WP_001295557.1.7479 WP_001295557.1.74793 WP_001295557.1.74811 WP_001295557.1.74844 WP_001295557.1.74852 WP_001295557.1.74854 WP_001295557.1.74860 WP_001295557.1.74867 WP_001295557.1.74873 WP_001295557.1.74879 WP_001295557.1.74880 WP_001295557.1.74885 WP_001295557.1.74889 WP_001295557.1.74895 WP_001295557.1.74914 WP_001295557.1.74962 WP_001295557.1.74975 WP_001295557.1.74993 WP_001295557.1.74998 WP_001295557.1.75003 WP_001295557.1.75021 WP_001295557.1.75029 WP_001295557.1.75030 WP_001295557.1.75087 WP_001295557.1.75100 WP_001295557.1.75136 WP_001295557.1.75138 WP_001295557.1.75139 WP_001295557.1.75143 WP_001295557.1.75145 WP_001295557.1.75149 WP_001295557.1.75155 WP_001295557.1.7516 WP_001295557.1.75181 WP_001295557.1.75209 WP_001295557.1.75219 WP_001295557.1.75221 WP_001295557.1.75228 WP_001295557.1.75243 WP_001295557.1.75247 WP_001295557.1.75254 WP_001295557.1.75270 WP_001295557.1.75272 WP_001295557.1.7536 WP_001295557.1.75360 WP_001295557.1.75367 WP_001295557.1.75382 WP_001295557.1.75419 WP_001295557.1.75428 WP_001295557.1.75435 WP_001295557.1.75465 WP_001295557.1.75491 WP_001295557.1.75515 WP_001295557.1.75529 WP_001295557.1.75537 WP_001295557.1.75557 WP_001295557.1.75568 WP_001295557.1.75588 WP_001295557.1.75594 WP_001295557.1.75602 WP_001295557.1.75612 WP_001295557.1.75629 WP_001295557.1.75644 WP_001295557.1.75653 WP_001295557.1.75672 WP_001295557.1.75676 WP_001295557.1.75679 WP_001295557.1.75687 WP_001295557.1.75696 WP_001295557.1.75698 WP_001295557.1.75699 WP_001295557.1.75735 WP_001295557.1.75758 WP_001295557.1.75767 WP_001295557.1.75786 WP_001295557.1.75803 WP_001295557.1.75808 WP_001295557.1.75839 WP_001295557.1.75853 WP_001295557.1.75892 WP_001295557.1.75918 WP_001295557.1.75922 WP_001295557.1.7597 WP_001295557.1.75973 WP_001295557.1.75983 WP_001295557.1.75995 WP_001295557.1.75999 WP_001295557.1.76005 WP_001295557.1.76009 WP_001295557.1.76019 WP_001295557.1.76030 WP_001295557.1.76039 WP_001295557.1.76057 WP_001295557.1.76087 WP_001295557.1.76089 WP_001295557.1.76118 WP_001295557.1.76119 WP_001295557.1.76129 WP_001295557.1.7613 WP_001295557.1.76184 WP_001295557.1.76194 WP_001295557.1.76196 WP_001295557.1.76211 WP_001295557.1.76237 WP_001295557.1.76305 WP_001295557.1.76312 WP_001295557.1.76335 WP_001295557.1.76361 WP_001295557.1.7637 WP_001295557.1.76376 WP_001295557.1.76384 WP_001295557.1.76387 WP_001295557.1.76390 WP_001295557.1.76446 WP_001295557.1.76448 WP_001295557.1.76452 WP_001295557.1.76462 WP_001295557.1.76466 WP_001295557.1.76469 WP_001295557.1.76542 WP_001295557.1.76544 WP_001295557.1.76547 WP_001295557.1.76562 WP_001295557.1.76595 WP_001295557.1.7661 WP_001295557.1.76612 WP_001295557.1.76643 WP_001295557.1.76656 WP_001295557.1.76701 WP_001295557.1.76705 WP_001295557.1.76751 WP_001295557.1.76759 WP_001295557.1.7680 WP_001295557.1.76815 WP_001295557.1.76840 WP_001295557.1.76884 WP_001295557.1.7689 WP_001295557.1.76909 WP_001295557.1.76918 WP_001295557.1.76933 WP_001295557.1.76948 WP_001295557.1.76965 WP_001295557.1.76966 WP_001295557.1.76994 WP_001295557.1.77007 WP_001295557.1.77015 WP_001295557.1.77022 WP_001295557.1.77057 WP_001295557.1.77070 WP_001295557.1.77081 WP_001295557.1.771 WP_001295557.1.77109 WP_001295557.1.77120 WP_001295557.1.77134 WP_001295557.1.77147 WP_001295557.1.77162 WP_001295557.1.77163 WP_001295557.1.77173 WP_001295557.1.77175 WP_001295557.1.77200 WP_001295557.1.77204 WP_001295557.1.77214 WP_001295557.1.77224 WP_001295557.1.77253 WP_001295557.1.77255 WP_001295557.1.77258 WP_001295557.1.7728 WP_001295557.1.77284 WP_001295557.1.77288 WP_001295557.1.7729 WP_001295557.1.77290 WP_001295557.1.77291 WP_001295557.1.7731 WP_001295557.1.77320 WP_001295557.1.77326 WP_001295557.1.77341 WP_001295557.1.77358 WP_001295557.1.77391 WP_001295557.1.77408 WP_001295557.1.77419 WP_001295557.1.77432 WP_001295557.1.77437 WP_001295557.1.77448 WP_001295557.1.77452 WP_001295557.1.77455 WP_001295557.1.77462 WP_001295557.1.7747 WP_001295557.1.77470 WP_001295557.1.77471 WP_001295557.1.77477 WP_001295557.1.77481 WP_001295557.1.77487 WP_001295557.1.775 WP_001295557.1.7750 WP_001295557.1.77503 WP_001295557.1.77511 WP_001295557.1.77542 WP_001295557.1.77551 WP_001295557.1.77581 WP_001295557.1.77595 WP_001295557.1.77600 WP_001295557.1.77608 WP_001295557.1.77626 WP_001295557.1.77636 WP_001295557.1.77648 WP_001295557.1.77657 WP_001295557.1.77725 WP_001295557.1.77741 WP_001295557.1.7775 WP_001295557.1.77767 WP_001295557.1.77768 WP_001295557.1.7780 WP_001295557.1.7781 WP_001295557.1.77826 WP_001295557.1.77833 WP_001295557.1.77876 WP_001295557.1.77929 WP_001295557.1.77949 WP_001295557.1.7795 WP_001295557.1.77950 WP_001295557.1.77999 WP_001295557.1.78000 WP_001295557.1.78007 WP_001295557.1.78010 WP_001295557.1.78059 WP_001295557.1.7806 WP_001295557.1.7808 WP_001295557.1.78089 WP_001295557.1.78097 WP_001295557.1.78099 WP_001295557.1.78101 WP_001295557.1.78102 WP_001295557.1.78131 WP_001295557.1.78183 WP_001295557.1.78187 WP_001295557.1.78188 WP_001295557.1.78196 WP_001295557.1.78202 WP_001295557.1.78233 WP_001295557.1.78235 WP_001295557.1.78297 WP_001295557.1.78305 WP_001295557.1.78321 WP_001295557.1.78337 WP_001295557.1.78340 WP_001295557.1.78368 WP_001295557.1.78376 WP_001295557.1.78390 WP_001295557.1.78413 WP_001295557.1.78445 WP_001295557.1.78453 WP_001295557.1.78462 WP_001295557.1.78463 WP_001295557.1.7847 WP_001295557.1.78481 WP_001295557.1.78491 WP_001295557.1.7851 WP_001295557.1.78515 WP_001295557.1.78527 WP_001295557.1.78553 WP_001295557.1.78572 WP_001295557.1.78575 WP_001295557.1.78581 WP_001295557.1.78583 WP_001295557.1.78586 WP_001295557.1.78610 WP_001295557.1.78612 WP_001295557.1.78615 WP_001295557.1.78622 WP_001295557.1.78645 WP_001295557.1.78677 WP_001295557.1.78683 WP_001295557.1.78696 WP_001295557.1.78698 WP_001295557.1.78706 WP_001295557.1.78714 WP_001295557.1.78718 WP_001295557.1.78746 WP_001295557.1.78750 WP_001295557.1.78757 WP_001295557.1.78773 WP_001295557.1.78775 WP_001295557.1.78791 WP_001295557.1.78814 WP_001295557.1.7883 WP_001295557.1.78843 WP_001295557.1.78845 WP_001295557.1.78854 WP_001295557.1.78888 WP_001295557.1.78891 WP_001295557.1.78893 WP_001295557.1.78895 WP_001295557.1.78919 WP_001295557.1.78953 WP_001295557.1.78955 WP_001295557.1.78956 WP_001295557.1.7896 WP_001295557.1.78966 WP_001295557.1.7898 WP_001295557.1.78996 WP_001295557.1.79002 WP_001295557.1.79004 WP_001295557.1.7901 WP_001295557.1.79065 WP_001295557.1.79075 WP_001295557.1.79086 WP_001295557.1.79088 WP_001295557.1.79090 WP_001295557.1.79092 WP_001295557.1.79137 WP_001295557.1.79159 WP_001295557.1.79226 WP_001295557.1.79243 WP_001295557.1.79246 WP_001295557.1.79248 WP_001295557.1.79249 WP_001295557.1.79276 WP_001295557.1.79306 WP_001295557.1.79308 WP_001295557.1.79312 WP_001295557.1.79342 WP_001295557.1.79343 WP_001295557.1.79346 WP_001295557.1.79356 WP_001295557.1.79365 WP_001295557.1.79368 WP_001295557.1.79369 WP_001295557.1.7937 WP_001295557.1.79389 WP_001295557.1.79391 WP_001295557.1.79416 WP_001295557.1.79443 WP_001295557.1.79464 WP_001295557.1.79478 WP_001295557.1.79505 WP_001295557.1.79519 WP_001295557.1.7952 WP_001295557.1.79525 WP_001295557.1.79526 WP_001295557.1.79540 WP_001295557.1.79558 WP_001295557.1.79591 WP_001295557.1.79606 WP_001295557.1.79619 WP_001295557.1.79640 WP_001295557.1.79685 WP_001295557.1.79713 WP_001295557.1.79749 WP_001295557.1.79764 WP_001295557.1.79800 WP_001295557.1.79816 WP_001295557.1.79824 WP_001295557.1.79840 WP_001295557.1.7985 WP_001295557.1.79866 WP_001295557.1.79869 WP_001295557.1.7987 WP_001295557.1.79871 WP_001295557.1.79877 WP_001295557.1.79922 WP_001295557.1.7993 WP_001295557.1.79930 WP_001295557.1.79931 WP_001295557.1.79932 WP_001295557.1.79933 WP_001295557.1.79936 WP_001295557.1.79944 WP_001295557.1.79952 WP_001295557.1.79955 WP_001295557.1.79973 WP_001295557.1.79984 WP_001295557.1.79995 WP_001295557.1.80 WP_001295557.1.80011 WP_001295557.1.80016 WP_001295557.1.80026 WP_001295557.1.8004 WP_001295557.1.80043 WP_001295557.1.80060 WP_001295557.1.8007 WP_001295557.1.80071 WP_001295557.1.80096 WP_001295557.1.80106 WP_001295557.1.80112 WP_001295557.1.80136 WP_001295557.1.80141 WP_001295557.1.80168 WP_001295557.1.80176 WP_001295557.1.80179 WP_001295557.1.80183 WP_001295557.1.80192 WP_001295557.1.80255 WP_001295557.1.80292 WP_001295557.1.80310 WP_001295557.1.80320 WP_001295557.1.80343 WP_001295557.1.80388 WP_001295557.1.80392 WP_001295557.1.804 WP_001295557.1.80402 WP_001295557.1.80426 WP_001295557.1.80428 WP_001295557.1.80440 WP_001295557.1.80444 WP_001295557.1.80456 WP_001295557.1.80484 WP_001295557.1.80517 WP_001295557.1.80519 WP_001295557.1.80524 WP_001295557.1.80545 WP_001295557.1.80558 WP_001295557.1.80559 WP_001295557.1.8057 WP_001295557.1.80594 WP_001295557.1.80612 WP_001295557.1.80626 WP_001295557.1.80662 WP_001295557.1.80666 WP_001295557.1.80676 WP_001295557.1.8068 WP_001295557.1.80709 WP_001295557.1.80731 WP_001295557.1.80736 WP_001295557.1.80737 WP_001295557.1.8074 WP_001295557.1.80753 WP_001295557.1.80754 WP_001295557.1.80756 WP_001295557.1.80768 WP_001295557.1.808 WP_001295557.1.80804 WP_001295557.1.80805 WP_001295557.1.80843 WP_001295557.1.80882 WP_001295557.1.80884 WP_001295557.1.80894 WP_001295557.1.8090 WP_001295557.1.8091 WP_001295557.1.80945 WP_001295557.1.80946 WP_001295557.1.80954 WP_001295557.1.80983 WP_001295557.1.80985 WP_001295557.1.810 WP_001295557.1.81026 WP_001295557.1.81032 WP_001295557.1.81034 WP_001295557.1.81054 WP_001295557.1.81056 WP_001295557.1.81071 WP_001295557.1.811 WP_001295557.1.81104 WP_001295557.1.81120 WP_001295557.1.81127 WP_001295557.1.81141 WP_001295557.1.81156 WP_001295557.1.81160 WP_001295557.1.81165 WP_001295557.1.8118 WP_001295557.1.81180 WP_001295557.1.81182 WP_001295557.1.81186 WP_001295557.1.8121 WP_001295557.1.81219 WP_001295557.1.81267 WP_001295557.1.81281 WP_001295557.1.81283 WP_001295557.1.81286 WP_001295557.1.8129 WP_001295557.1.81298 WP_001295557.1.81313 WP_001295557.1.81316 WP_001295557.1.81347 WP_001295557.1.81376 WP_001295557.1.81391 WP_001295557.1.81396 WP_001295557.1.81418 WP_001295557.1.81438 WP_001295557.1.81469 WP_001295557.1.81475 WP_001295557.1.81484 WP_001295557.1.81517 WP_001295557.1.8156 WP_001295557.1.81576 WP_001295557.1.81577 WP_001295557.1.81580 WP_001295557.1.81588 WP_001295557.1.81589 WP_001295557.1.81596 WP_001295557.1.81602 WP_001295557.1.81624 WP_001295557.1.81625 WP_001295557.1.81688 WP_001295557.1.81692 WP_001295557.1.81715 WP_001295557.1.8172 WP_001295557.1.81761 WP_001295557.1.81806 WP_001295557.1.81819 WP_001295557.1.8183 WP_001295557.1.81832 WP_001295557.1.81869 WP_001295557.1.81881 WP_001295557.1.81888 WP_001295557.1.81935 WP_001295557.1.81939 WP_001295557.1.81952 WP_001295557.1.81972 WP_001295557.1.82 WP_001295557.1.82008 WP_001295557.1.82032 WP_001295557.1.82059 WP_001295557.1.82061 WP_001295557.1.82062 WP_001295557.1.82074 WP_001295557.1.82095 WP_001295557.1.82106 WP_001295557.1.82116 WP_001295557.1.82123 WP_001295557.1.82137 WP_001295557.1.82166 WP_001295557.1.82217 WP_001295557.1.82239 WP_001295557.1.82240 WP_001295557.1.82242 WP_001295557.1.82246 WP_001295557.1.82275 WP_001295557.1.82280 WP_001295557.1.82316 WP_001295557.1.82320 WP_001295557.1.82326 WP_001295557.1.82330 WP_001295557.1.8235 WP_001295557.1.82378 WP_001295557.1.82438 WP_001295557.1.82439 WP_001295557.1.82485 WP_001295557.1.82499 WP_001295557.1.82514 WP_001295557.1.82527 WP_001295557.1.82536 WP_001295557.1.82539 WP_001295557.1.8255 WP_001295557.1.82572 WP_001295557.1.82589 WP_001295557.1.82614 WP_001295557.1.82626 WP_001295557.1.82647 WP_001295557.1.82661 WP_001295557.1.82682 WP_001295557.1.82691 WP_001295557.1.82700 WP_001295557.1.82705 WP_001295557.1.82711 WP_001295557.1.82715 WP_001295557.1.82747 WP_001295557.1.82754 WP_001295557.1.8277 WP_001295557.1.82776 WP_001295557.1.82780 WP_001295557.1.82784 WP_001295557.1.82799 WP_001295557.1.82816 WP_001295557.1.82831 WP_001295557.1.82853 WP_001295557.1.82901 WP_001295557.1.82902 WP_001295557.1.82923 WP_001295557.1.8295 WP_001295557.1.83020 WP_001295557.1.83033 WP_001295557.1.83036 WP_001295557.1.83051 WP_001295557.1.83059 WP_001295557.1.8306 WP_001295557.1.8308 WP_001295557.1.83093 WP_001295557.1.83097 WP_001295557.1.831 WP_001295557.1.83118 WP_001295557.1.83125 WP_001295557.1.83127 WP_001295557.1.83140 WP_001295557.1.83144 WP_001295557.1.83151 WP_001295557.1.83160 WP_001295557.1.83177 WP_001295557.1.83205 WP_001295557.1.83218 WP_001295557.1.83224 WP_001295557.1.83238 WP_001295557.1.83253 WP_001295557.1.83313 WP_001295557.1.83330 WP_001295557.1.83375 WP_001295557.1.83393 WP_001295557.1.83415 WP_001295557.1.8345 WP_001295557.1.83466 WP_001295557.1.83481 WP_001295557.1.83506 WP_001295557.1.83537 WP_001295557.1.83544 WP_001295557.1.83564 WP_001295557.1.83582 WP_001295557.1.83584 WP_001295557.1.83668 WP_001295557.1.8368 WP_001295557.1.83684 WP_001295557.1.83706 WP_001295557.1.83735 WP_001295557.1.83762 WP_001295557.1.83781 WP_001295557.1.83820 WP_001295557.1.8384 WP_001295557.1.8386 WP_001295557.1.83879 WP_001295557.1.83911 WP_001295557.1.83936 WP_001295557.1.83941 WP_001295557.1.84004 WP_001295557.1.84014 WP_001295557.1.84021 WP_001295557.1.84060 WP_001295557.1.84074 WP_001295557.1.8408 WP_001295557.1.8411 WP_001295557.1.84140 WP_001295557.1.84172 WP_001295557.1.84185 WP_001295557.1.84197 WP_001295557.1.84210 WP_001295557.1.84215 WP_001295557.1.84221 WP_001295557.1.84298 WP_001295557.1.84313 WP_001295557.1.84316 WP_001295557.1.84326 WP_001295557.1.84331 WP_001295557.1.84339 WP_001295557.1.84348 WP_001295557.1.84402 WP_001295557.1.84405 WP_001295557.1.84410 WP_001295557.1.84436 WP_001295557.1.8444 WP_001295557.1.84462 WP_001295557.1.84464 WP_001295557.1.84467 WP_001295557.1.8447 WP_001295557.1.84476 WP_001295557.1.84484 WP_001295557.1.84511 WP_001295557.1.84518 WP_001295557.1.84531 WP_001295557.1.84534 WP_001295557.1.84584 WP_001295557.1.84639 WP_001295557.1.84656 WP_001295557.1.84668 WP_001295557.1.84675 WP_001295557.1.84697 WP_001295557.1.8470 WP_001295557.1.84738 WP_001295557.1.84740 WP_001295557.1.84768 WP_001295557.1.84797 WP_001295557.1.84841 WP_001295557.1.84850 WP_001295557.1.84875 WP_001295557.1.84877 WP_001295557.1.84878 WP_001295557.1.84881 WP_001295557.1.84893 WP_001295557.1.84894 WP_001295557.1.84916 WP_001295557.1.84929 WP_001295557.1.84941 WP_001295557.1.84948 WP_001295557.1.84966 WP_001295557.1.84972 WP_001295557.1.84977 WP_001295557.1.84989 WP_001295557.1.84994 WP_001295557.1.85002 WP_001295557.1.85011 WP_001295557.1.85048 WP_001295557.1.85052 WP_001295557.1.85077 WP_001295557.1.85098 WP_001295557.1.85105 WP_001295557.1.85106 WP_001295557.1.85112 WP_001295557.1.85125 WP_001295557.1.85129 WP_001295557.1.85138 WP_001295557.1.85141 WP_001295557.1.85155 WP_001295557.1.85156 WP_001295557.1.85175 WP_001295557.1.85188 WP_001295557.1.85216 WP_001295557.1.85247 WP_001295557.1.85255 WP_001295557.1.85260 WP_001295557.1.85305 WP_001295557.1.85310 WP_001295557.1.85315 WP_001295557.1.85320 WP_001295557.1.85323 WP_001295557.1.85329 WP_001295557.1.85335 WP_001295557.1.85369 WP_001295557.1.85384 WP_001295557.1.85385 WP_001295557.1.85435 WP_001295557.1.85500 WP_001295557.1.85504 WP_001295557.1.85546 WP_001295557.1.85554 WP_001295557.1.85556 WP_001295557.1.8560 WP_001295557.1.85601 WP_001295557.1.85621 WP_001295557.1.85623 WP_001295557.1.8564 WP_001295557.1.85657 WP_001295557.1.85685 WP_001295557.1.85752 WP_001295557.1.85767 WP_001295557.1.85773 WP_001295557.1.85781 WP_001295557.1.8579 WP_001295557.1.85793 WP_001295557.1.85800 WP_001295557.1.85806 WP_001295557.1.85857 WP_001295557.1.85895 WP_001295557.1.8592 WP_001295557.1.85939 WP_001295557.1.85944 WP_001295557.1.85948 WP_001295557.1.86 WP_001295557.1.86001 WP_001295557.1.86016 WP_001295557.1.8603 WP_001295557.1.86035 WP_001295557.1.86063 WP_001295557.1.8607 WP_001295557.1.86104 WP_001295557.1.86105 WP_001295557.1.86110 WP_001295557.1.86145 WP_001295557.1.86149 WP_001295557.1.86161 WP_001295557.1.86166 WP_001295557.1.86176 WP_001295557.1.86179 WP_001295557.1.86189 WP_001295557.1.86196 WP_001295557.1.86210 WP_001295557.1.86227 WP_001295557.1.86228 WP_001295557.1.86234 WP_001295557.1.86261 WP_001295557.1.86263 WP_001295557.1.86266 WP_001295557.1.86276 WP_001295557.1.86280 WP_001295557.1.86283 WP_001295557.1.86294 WP_001295557.1.86307 WP_001295557.1.8635 WP_001295557.1.86353 WP_001295557.1.86355 WP_001295557.1.86364 WP_001295557.1.86371 WP_001295557.1.86376 WP_001295557.1.86393 WP_001295557.1.86412 WP_001295557.1.86437 WP_001295557.1.86451 WP_001295557.1.86452 WP_001295557.1.86454 WP_001295557.1.86461 WP_001295557.1.86475 WP_001295557.1.86492 WP_001295557.1.86518 WP_001295557.1.8652 WP_001295557.1.86583 WP_001295557.1.86586 WP_001295557.1.86598 WP_001295557.1.86609 WP_001295557.1.86617 WP_001295557.1.86627 WP_001295557.1.86640 WP_001295557.1.86667 WP_001295557.1.86673 WP_001295557.1.86674 WP_001295557.1.86691 WP_001295557.1.86707 WP_001295557.1.86717 WP_001295557.1.86727 WP_001295557.1.86734 WP_001295557.1.86753 WP_001295557.1.86760 WP_001295557.1.86768 WP_001295557.1.86787 WP_001295557.1.8679 WP_001295557.1.86833 WP_001295557.1.86846 WP_001295557.1.86848 WP_001295557.1.8687 WP_001295557.1.86935 WP_001295557.1.86956 WP_001295557.1.86959 WP_001295557.1.86975 WP_001295557.1.86997 WP_001295557.1.87043 WP_001295557.1.8705 WP_001295557.1.87059 WP_001295557.1.87067 WP_001295557.1.87075 WP_001295557.1.87102 WP_001295557.1.87109 WP_001295557.1.8711 WP_001295557.1.87147 WP_001295557.1.87177 WP_001295557.1.87189 WP_001295557.1.87199 WP_001295557.1.87205 WP_001295557.1.87249 WP_001295557.1.87310 WP_001295557.1.87339 WP_001295557.1.87358 WP_001295557.1.87371 WP_001295557.1.87389 WP_001295557.1.87400 WP_001295557.1.87410 WP_001295557.1.87443 WP_001295557.1.87465 WP_001295557.1.87491 WP_001295557.1.87504 WP_001295557.1.87557 WP_001295557.1.87563 WP_001295557.1.87568 WP_001295557.1.87574 WP_001295557.1.87581 WP_001295557.1.87590 WP_001295557.1.87607 WP_001295557.1.87608 WP_001295557.1.87610 WP_001295557.1.87633 WP_001295557.1.87635 WP_001295557.1.87639 WP_001295557.1.87655 WP_001295557.1.87675 WP_001295557.1.87694 WP_001295557.1.87696 WP_001295557.1.8771 WP_001295557.1.87721 WP_001295557.1.87726 WP_001295557.1.87728 WP_001295557.1.87738 WP_001295557.1.8778 WP_001295557.1.87786 WP_001295557.1.87788 WP_001295557.1.87789 WP_001295557.1.87822 WP_001295557.1.87834 WP_001295557.1.87857 WP_001295557.1.87883 WP_001295557.1.87914 WP_001295557.1.87919 WP_001295557.1.87973 WP_001295557.1.87976 WP_001295557.1.87980 WP_001295557.1.87984 WP_001295557.1.87989 WP_001295557.1.87990 WP_001295557.1.880 WP_001295557.1.88017 WP_001295557.1.88020 WP_001295557.1.88066 WP_001295557.1.8807 WP_001295557.1.88088 WP_001295557.1.88110 WP_001295557.1.88119 WP_001295557.1.88147 WP_001295557.1.88149 WP_001295557.1.88155 WP_001295557.1.88189 WP_001295557.1.8822 WP_001295557.1.88234 WP_001295557.1.88238 WP_001295557.1.88260 WP_001295557.1.88285 WP_001295557.1.88301 WP_001295557.1.88304 WP_001295557.1.88336 WP_001295557.1.88352 WP_001295557.1.88376 WP_001295557.1.88379 WP_001295557.1.88413 WP_001295557.1.88427 WP_001295557.1.88434 WP_001295557.1.88438 WP_001295557.1.88462 WP_001295557.1.88467 WP_001295557.1.88499 WP_001295557.1.88505 WP_001295557.1.88527 WP_001295557.1.88535 WP_001295557.1.8854 WP_001295557.1.8855 WP_001295557.1.88557 WP_001295557.1.88562 WP_001295557.1.88577 WP_001295557.1.88598 WP_001295557.1.88603 WP_001295557.1.88607 WP_001295557.1.88631 WP_001295557.1.88646 WP_001295557.1.88667 WP_001295557.1.88678 WP_001295557.1.88685 WP_001295557.1.88686 WP_001295557.1.88709 WP_001295557.1.88710 WP_001295557.1.88711 WP_001295557.1.88717 WP_001295557.1.88720 WP_001295557.1.88729 WP_001295557.1.88732 WP_001295557.1.88752 WP_001295557.1.88757 WP_001295557.1.8879 WP_001295557.1.88803 WP_001295557.1.88834 WP_001295557.1.88864 WP_001295557.1.88883 WP_001295557.1.88941 WP_001295557.1.88950 WP_001295557.1.88953 WP_001295557.1.88961 WP_001295557.1.88997 WP_001295557.1.89018 WP_001295557.1.8906 WP_001295557.1.89067 WP_001295557.1.89069 WP_001295557.1.89090 WP_001295557.1.89097 WP_001295557.1.89099 WP_001295557.1.89111 WP_001295557.1.89150 WP_001295557.1.89163 WP_001295557.1.89165 WP_001295557.1.89197 WP_001295557.1.89200 WP_001295557.1.89203 WP_001295557.1.89214 WP_001295557.1.89217 WP_001295557.1.89255 WP_001295557.1.89305 WP_001295557.1.89334 WP_001295557.1.89335 WP_001295557.1.89351 WP_001295557.1.89379 WP_001295557.1.894 WP_001295557.1.89400 WP_001295557.1.89403 WP_001295557.1.89427 WP_001295557.1.89432 WP_001295557.1.8945 WP_001295557.1.89455 WP_001295557.1.89458 WP_001295557.1.89468 WP_001295557.1.89471 WP_001295557.1.89479 WP_001295557.1.89492 WP_001295557.1.89510 WP_001295557.1.89551 WP_001295557.1.89601 WP_001295557.1.89605 WP_001295557.1.89627 WP_001295557.1.89631 WP_001295557.1.89646 WP_001295557.1.89656 WP_001295557.1.89674 WP_001295557.1.89679 WP_001295557.1.89700 WP_001295557.1.89710 WP_001295557.1.89747 WP_001295557.1.89768 WP_001295557.1.89781 WP_001295557.1.89788 WP_001295557.1.89818 WP_001295557.1.89839 WP_001295557.1.89841 WP_001295557.1.89852 WP_001295557.1.89859 WP_001295557.1.89879 WP_001295557.1.89895 WP_001295557.1.89899 WP_001295557.1.89915 WP_001295557.1.89917 WP_001295557.1.89918 WP_001295557.1.89920 WP_001295557.1.89923 WP_001295557.1.89925 WP_001295557.1.89927 WP_001295557.1.89977 WP_001295557.1.90017 WP_001295557.1.90050 WP_001295557.1.90063 WP_001295557.1.90078 WP_001295557.1.9009 WP_001295557.1.9010 WP_001295557.1.90115 WP_001295557.1.90128 WP_001295557.1.90146 WP_001295557.1.90168 WP_001295557.1.90171 WP_001295557.1.90182 WP_001295557.1.90205 WP_001295557.1.90249 WP_001295557.1.90256 WP_001295557.1.90266 WP_001295557.1.90270 WP_001295557.1.90332 WP_001295557.1.90346 WP_001295557.1.90349 WP_001295557.1.90358 WP_001295557.1.9036 WP_001295557.1.9037 WP_001295557.1.90389 WP_001295557.1.90435 WP_001295557.1.90436 WP_001295557.1.90441 WP_001295557.1.90449 WP_001295557.1.90467 WP_001295557.1.90511 WP_001295557.1.90520 WP_001295557.1.90536 WP_001295557.1.90542 WP_001295557.1.90547 WP_001295557.1.9059 WP_001295557.1.90591 WP_001295557.1.90602 WP_001295557.1.9061 WP_001295557.1.90626 WP_001295557.1.90690 WP_001295557.1.90703 WP_001295557.1.90706 WP_001295557.1.90758 WP_001295557.1.90799 WP_001295557.1.9081 WP_001295557.1.90813 WP_001295557.1.90822 WP_001295557.1.90828 WP_001295557.1.90834 WP_001295557.1.9084 WP_001295557.1.90842 WP_001295557.1.90856 WP_001295557.1.90864 WP_001295557.1.90865 WP_001295557.1.9087 WP_001295557.1.90873 WP_001295557.1.90890 WP_001295557.1.909 WP_001295557.1.90924 WP_001295557.1.90951 WP_001295557.1.90960 WP_001295557.1.90979 WP_001295557.1.90988 WP_001295557.1.90997 WP_001295557.1.91 WP_001295557.1.91010 WP_001295557.1.91018 WP_001295557.1.9104 WP_001295557.1.91094 WP_001295557.1.91113 WP_001295557.1.91117 WP_001295557.1.91121 WP_001295557.1.91138 WP_001295557.1.91143 WP_001295557.1.91170 WP_001295557.1.9118 WP_001295557.1.91182 WP_001295557.1.9119 WP_001295557.1.91213 WP_001295557.1.91220 WP_001295557.1.91268 WP_001295557.1.91277 WP_001295557.1.91290 WP_001295557.1.91340 WP_001295557.1.91341 WP_001295557.1.91354 WP_001295557.1.91397 WP_001295557.1.91445 WP_001295557.1.91462 WP_001295557.1.91482 WP_001295557.1.91485 WP_001295557.1.915 WP_001295557.1.91511 WP_001295557.1.91515 WP_001295557.1.91516 WP_001295557.1.91526 WP_001295557.1.91551 WP_001295557.1.91565 WP_001295557.1.9157 WP_001295557.1.91594 WP_001295557.1.91596 WP_001295557.1.91626 WP_001295557.1.91630 WP_001295557.1.91640 WP_001295557.1.91643 WP_001295557.1.91644 WP_001295557.1.91666 WP_001295557.1.91672 WP_001295557.1.91685 WP_001295557.1.9169 WP_001295557.1.91701 WP_001295557.1.9171 WP_001295557.1.91739 WP_001295557.1.91777 WP_001295557.1.91779 WP_001295557.1.91782 WP_001295557.1.91787 WP_001295557.1.91793 WP_001295557.1.91814 WP_001295557.1.91843 WP_001295557.1.91850 WP_001295557.1.91879 WP_001295557.1.91887 WP_001295557.1.91893 WP_001295557.1.91951 WP_001295557.1.91954 WP_001295557.1.91959 WP_001295557.1.91965 WP_001295557.1.91971 WP_001295557.1.9199 WP_001295557.1.92005 WP_001295557.1.92014 WP_001295557.1.92019 WP_001295557.1.92025 WP_001295557.1.92029 WP_001295557.1.92031 WP_001295557.1.92048 WP_001295557.1.92053 WP_001295557.1.92058 WP_001295557.1.92096 WP_001295557.1.921 WP_001295557.1.92102 WP_001295557.1.92114 WP_001295557.1.9215 WP_001295557.1.92161 WP_001295557.1.92180 WP_001295557.1.92195 WP_001295557.1.92201 WP_001295557.1.92215 WP_001295557.1.92224 WP_001295557.1.92276 WP_001295557.1.92295 WP_001295557.1.92304 WP_001295557.1.92305 WP_001295557.1.92311 WP_001295557.1.92323 WP_001295557.1.92361 WP_001295557.1.92384 WP_001295557.1.924 WP_001295557.1.92403 WP_001295557.1.92434 WP_001295557.1.92462 WP_001295557.1.92473 WP_001295557.1.92495 WP_001295557.1.92496 WP_001295557.1.92506 WP_001295557.1.92532 WP_001295557.1.92535 WP_001295557.1.9255 WP_001295557.1.92568 WP_001295557.1.92571 WP_001295557.1.92577 WP_001295557.1.92614 WP_001295557.1.92615 WP_001295557.1.92634 WP_001295557.1.92638 WP_001295557.1.9264 WP_001295557.1.92648 WP_001295557.1.9266 WP_001295557.1.92668 WP_001295557.1.92693 WP_001295557.1.92708 WP_001295557.1.92719 WP_001295557.1.92742 WP_001295557.1.92780 WP_001295557.1.92781 WP_001295557.1.92792 WP_001295557.1.92793 WP_001295557.1.92796 WP_001295557.1.92845 WP_001295557.1.92865 WP_001295557.1.92932 WP_001295557.1.92943 WP_001295557.1.92953 WP_001295557.1.92989 WP_001295557.1.92991 WP_001295557.1.93005 WP_001295557.1.93016 WP_001295557.1.93017 WP_001295557.1.93019 WP_001295557.1.93033 WP_001295557.1.93048 WP_001295557.1.93054 WP_001295557.1.93072 WP_001295557.1.93085 WP_001295557.1.93100 WP_001295557.1.93112 WP_001295557.1.93133 WP_001295557.1.93138 WP_001295557.1.93150 WP_001295557.1.93175 WP_001295557.1.93185 WP_001295557.1.93233 WP_001295557.1.93252 WP_001295557.1.93267 WP_001295557.1.9327 WP_001295557.1.93276 WP_001295557.1.93291 WP_001295557.1.93309 WP_001295557.1.93326 WP_001295557.1.93338 WP_001295557.1.93379 WP_001295557.1.93388 WP_001295557.1.934 WP_001295557.1.93431 WP_001295557.1.93453 WP_001295557.1.93463 WP_001295557.1.93464 WP_001295557.1.93468 WP_001295557.1.93509 WP_001295557.1.93533 WP_001295557.1.93552 WP_001295557.1.93569 WP_001295557.1.93621 WP_001295557.1.93629 WP_001295557.1.93634 WP_001295557.1.93637 WP_001295557.1.93639 WP_001295557.1.93652 WP_001295557.1.93673 WP_001295557.1.93679 WP_001295557.1.93694 WP_001295557.1.93716 WP_001295557.1.93733 WP_001295557.1.93737 WP_001295557.1.93742 WP_001295557.1.93743 WP_001295557.1.93745 WP_001295557.1.93755 WP_001295557.1.938 WP_001295557.1.93800 WP_001295557.1.93873 WP_001295557.1.93877 WP_001295557.1.939 WP_001295557.1.93900 WP_001295557.1.93911 WP_001295557.1.93918 WP_001295557.1.93921 WP_001295557.1.93922 WP_001295557.1.93939 WP_001295557.1.93952 WP_001295557.1.93971 WP_001295557.1.94008 WP_001295557.1.94011 WP_001295557.1.94025 WP_001295557.1.94028 WP_001295557.1.94035 WP_001295557.1.94057 WP_001295557.1.94069 WP_001295557.1.94156 WP_001295557.1.9416 WP_001295557.1.94176 WP_001295557.1.94187 WP_001295557.1.9420 WP_001295557.1.94232 WP_001295557.1.94271 WP_001295557.1.94282 WP_001295557.1.94298 WP_001295557.1.94317 WP_001295557.1.94353 WP_001295557.1.94367 WP_001295557.1.94388 WP_001295557.1.94404 WP_001295557.1.94417 WP_001295557.1.94429 WP_001295557.1.94430 WP_001295557.1.94436 WP_001295557.1.94438 WP_001295557.1.94445 WP_001295557.1.94446 WP_001295557.1.94468 WP_001295557.1.94497 WP_001295557.1.94507 WP_001295557.1.94516 WP_001295557.1.94523 WP_001295557.1.94542 WP_001295557.1.94548 WP_001295557.1.9457 WP_001295557.1.94578 WP_001295557.1.94619 WP_001295557.1.94626 WP_001295557.1.94646 WP_001295557.1.94653 WP_001295557.1.94686 WP_001295557.1.94690 WP_001295557.1.94692 WP_001295557.1.94695 WP_001295557.1.94704 WP_001295557.1.94738 WP_001295557.1.94739 WP_001295557.1.94753 WP_001295557.1.94754 WP_001295557.1.94764 WP_001295557.1.94787 WP_001295557.1.948 WP_001295557.1.94806 WP_001295557.1.94808 WP_001295557.1.94822 WP_001295557.1.94836 WP_001295557.1.94847 WP_001295557.1.94877 WP_001295557.1.94880 WP_001295557.1.94889 WP_001295557.1.9489 WP_001295557.1.94892 WP_001295557.1.94898 WP_001295557.1.949 WP_001295557.1.94903 WP_001295557.1.9491 WP_001295557.1.94927 WP_001295557.1.94934 WP_001295557.1.94935 WP_001295557.1.94938 WP_001295557.1.94949 WP_001295557.1.94955 WP_001295557.1.94963 WP_001295557.1.94993 WP_001295557.1.94997 WP_001295557.1.95005 WP_001295557.1.95036 WP_001295557.1.95037 WP_001295557.1.95062 WP_001295557.1.95080 WP_001295557.1.95105 WP_001295557.1.9513 WP_001295557.1.95161 WP_001295557.1.95198 WP_001295557.1.95233 WP_001295557.1.95243 WP_001295557.1.95244 WP_001295557.1.95275 WP_001295557.1.95310 WP_001295557.1.95329 WP_001295557.1.95364 WP_001295557.1.95366 WP_001295557.1.95368 WP_001295557.1.95378 WP_001295557.1.95381 WP_001295557.1.95390 WP_001295557.1.95395 WP_001295557.1.95400 WP_001295557.1.95403 WP_001295557.1.95424 WP_001295557.1.95428 WP_001295557.1.95431 WP_001295557.1.95438 WP_001295557.1.95449 WP_001295557.1.95490 WP_001295557.1.95518 WP_001295557.1.95563 WP_001295557.1.9559 WP_001295557.1.95595 WP_001295557.1.95596 WP_001295557.1.95604 WP_001295557.1.95611 WP_001295557.1.95634 WP_001295557.1.95655 WP_001295557.1.9566 WP_001295557.1.95666 WP_001295557.1.95680 WP_001295557.1.95756 WP_001295557.1.95759 WP_001295557.1.95771 WP_001295557.1.95783 WP_001295557.1.95784 WP_001295557.1.95800 WP_001295557.1.95821 WP_001295557.1.95824 WP_001295557.1.95827 WP_001295557.1.95835 WP_001295557.1.95846 WP_001295557.1.95849 WP_001295557.1.95858 WP_001295557.1.95861 WP_001295557.1.95865 WP_001295557.1.95869 WP_001295557.1.95916 WP_001295557.1.95919 WP_001295557.1.95929 WP_001295557.1.95931 WP_001295557.1.95932 WP_001295557.1.95951 WP_001295557.1.960 WP_001295557.1.96015 WP_001295557.1.96032 WP_001295557.1.96053 WP_001295557.1.96059 WP_001295557.1.96066 WP_001295557.1.96086 WP_001295557.1.96097 WP_001295557.1.96110 WP_001295557.1.96114 WP_001295557.1.96143 WP_001295557.1.96145 WP_001295557.1.96177 WP_001295557.1.96215 WP_001295557.1.96222 WP_001295557.1.96223 WP_001295557.1.96229 WP_001295557.1.96247 WP_001295557.1.96253 WP_001295557.1.96263 WP_001295557.1.96278 WP_001295557.1.96279 WP_001295557.1.96290 WP_001295557.1.96293 WP_001295557.1.96299 WP_001295557.1.96303 WP_001295557.1.9631 WP_001295557.1.96341 WP_001295557.1.96378 WP_001295557.1.96392 WP_001295557.1.96394 WP_001295557.1.9641 WP_001295557.1.96417 WP_001295557.1.96420 WP_001295557.1.96450 WP_001295557.1.96457 WP_001295557.1.96479 WP_001295557.1.96480 WP_001295557.1.96484 WP_001295557.1.96494 WP_001295557.1.965 WP_001295557.1.96519 WP_001295557.1.96541 WP_001295557.1.96562 WP_001295557.1.9657 WP_001295557.1.96585 WP_001295557.1.96609 WP_001295557.1.9661 WP_001295557.1.96617 WP_001295557.1.96633 WP_001295557.1.96650 WP_001295557.1.96659 WP_001295557.1.96676 WP_001295557.1.9668 WP_001295557.1.96683 WP_001295557.1.96695 WP_001295557.1.96701 WP_001295557.1.9671 WP_001295557.1.96743 WP_001295557.1.96753 WP_001295557.1.96759 WP_001295557.1.96779 WP_001295557.1.96797 WP_001295557.1.96817 WP_001295557.1.96850 WP_001295557.1.96864 WP_001295557.1.96894 WP_001295557.1.9690 WP_001295557.1.96907 WP_001295557.1.96924 WP_001295557.1.96944 WP_001295557.1.96971 WP_001295557.1.96984 WP_001295557.1.96989 WP_001295557.1.97011 WP_001295557.1.97027 WP_001295557.1.97049 WP_001295557.1.97059 WP_001295557.1.9708 WP_001295557.1.97119 WP_001295557.1.97123 WP_001295557.1.97147 WP_001295557.1.97195 WP_001295557.1.97200 WP_001295557.1.97226 WP_001295557.1.9723 WP_001295557.1.97231 WP_001295557.1.97238 WP_001295557.1.97247 WP_001295557.1.97248 WP_001295557.1.97269 WP_001295557.1.97282 WP_001295557.1.97344 WP_001295557.1.97351 WP_001295557.1.97356 WP_001295557.1.97360 WP_001295557.1.97361 WP_001295557.1.97379 WP_001295557.1.97387 WP_001295557.1.97418 WP_001295557.1.97421 WP_001295557.1.97434 WP_001295557.1.97437 WP_001295557.1.97439 WP_001295557.1.97459 WP_001295557.1.97464 WP_001295557.1.9747 WP_001295557.1.97490 WP_001295557.1.97502 WP_001295557.1.97525 WP_001295557.1.97527 WP_001295557.1.97538 WP_001295557.1.97544 WP_001295557.1.97549 WP_001295557.1.97560 WP_001295557.1.97571 WP_001295557.1.97619 WP_001295557.1.97654 WP_001295557.1.97675 WP_001295557.1.97677 WP_001295557.1.97685 WP_001295557.1.97705 WP_001295557.1.97711 WP_001295557.1.97770 WP_001295557.1.97775 WP_001295557.1.97778 WP_001295557.1.978 WP_001295557.1.97802 WP_001295557.1.97822 WP_001295557.1.97823 WP_001295557.1.97825 WP_001295557.1.97895 WP_001295557.1.97930 WP_001295557.1.97932 WP_001295557.1.97937 WP_001295557.1.97962 WP_001295557.1.97982 WP_001295557.1.97996 WP_001295557.1.98000 WP_001295557.1.98026 WP_001295557.1.9803 WP_001295557.1.98082 WP_001295557.1.98102 WP_001295557.1.98115 WP_001295557.1.9816 WP_001295557.1.98202 WP_001295557.1.98208 WP_001295557.1.98220 WP_001295557.1.98232 WP_001295557.1.98235 WP_001295557.1.98239 WP_001295557.1.98241 WP_001295557.1.98251 WP_001295557.1.98284 WP_001295557.1.98292 WP_001295557.1.98294 WP_001295557.1.98301 WP_001295557.1.98355 WP_001295557.1.98357 WP_001295557.1.98404 WP_001295557.1.98424 WP_001295557.1.98429 WP_001295557.1.9844 WP_001295557.1.98442 WP_001295557.1.98451 WP_001295557.1.98466 WP_001295557.1.98480 WP_001295557.1.98484 WP_001295557.1.98498 WP_001295557.1.98549 WP_001295557.1.98578 WP_001295557.1.9858 WP_001295557.1.98587 WP_001295557.1.98603 WP_001295557.1.98614 WP_001295557.1.98626 WP_001295557.1.98628 WP_001295557.1.98633 WP_001295557.1.9864 WP_001295557.1.98641 WP_001295557.1.98654 WP_001295557.1.98665 WP_001295557.1.98668 WP_001295557.1.98683 WP_001295557.1.98702 WP_001295557.1.98727 WP_001295557.1.98757 WP_001295557.1.98775 WP_001295557.1.98776 WP_001295557.1.98784 WP_001295557.1.98795 WP_001295557.1.98875 WP_001295557.1.98886 WP_001295557.1.98908 WP_001295557.1.98976 WP_001295557.1.98988 WP_001295557.1.99006 WP_001295557.1.99046 WP_001295557.1.99053 WP_001295557.1.9907 WP_001295557.1.99110 WP_001295557.1.99168 WP_001295557.1.99182 WP_001295557.1.99209 WP_001295557.1.99246 WP_001295557.1.99265 WP_001295557.1.99292 WP_001295557.1.99295 WP_001295557.1.9930 WP_001295557.1.99302 WP_001295557.1.99304 WP_001295557.1.99306 WP_001295557.1.99307 WP_001295557.1.99310 WP_001295557.1.99319 WP_001295557.1.99334 WP_001295557.1.99345 WP_001295557.1.99349 WP_001295557.1.99361 WP_001295557.1.99366 WP_001295557.1.99392 WP_001295557.1.9940 WP_001295557.1.99400 WP_001295557.1.99401 WP_001295557.1.99427 WP_001295557.1.99446 WP_001295557.1.99453 WP_001295557.1.99458 WP_001295557.1.99471 WP_001295557.1.99475 WP_001295557.1.99486 WP_001295557.1.99498 WP_001295557.1.9950 WP_001295557.1.99511 WP_001295557.1.99534 WP_001295557.1.99549 WP_001295557.1.99562 WP_001295557.1.99592 WP_001295557.1.99602 WP_001295557.1.99603 WP_001295557.1.99619 WP_001295557.1.99632 WP_001295557.1.99641 WP_001295557.1.99666 WP_001295557.1.99698 WP_001295557.1.99734 WP_001295557.1.99774 WP_001295557.1.99782 WP_001295557.1.99791 WP_001295557.1.99804 WP_001295557.1.99827 WP_001295557.1.99869 WP_001295557.1.99874 WP_001295557.1.99891 WP_001295557.1.99892 WP_001295557.1.99912 WP_001295557.1.99929 YP_002409595.1.10275 YP_006121515.1.29421 YP_006777321.1.12065 gi|74313734|ref|YP_312153.1| gi|16131087|ref|NP_417664.1| gi|386620810|ref|YP_006140390.1| gi|544577746|ref|YP_008573270.1| gi|407471171|ref|YP_006782386.1| gi|218696902|ref|YP_002404569.1| gi|291284571|ref|YP_003501389.1| gi|387613887|ref|YP_006117003.1| gi|260857324|ref|YP_003231215.1| gi|251786467|ref|YP_003000771.1| gi|387622859|ref|YP_006130487.1| 390807 APC64768 gi|117625489|ref|YP_858812.1| gi|544391682|ref|YP_008566363.1| gi|386626003|ref|YP_006145731.1| gi|218555767|ref|YP_002388680.1| gi|378711348|ref|YP_005276241.1| gi|443619270|ref|YP_007383126.1| gi|386706463|ref|YP_006170310.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]