SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|253772015|ref|YP_003034846.1| from Escherichia coli 'BL21-Gold(DE3)pLysS AG'

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|253772015|ref|YP_003034846.1|
Domain Number 1 Region: 3-193
Classification Level Classification E-value
Superfamily SIS domain 1.45e-76
Family mono-SIS domain 0.00000317
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|253772015|ref|YP_003034846.1|
Sequence length 196
Comment DnaA initiator-associating protein DiaA [Escherichia coli 'BL21-Gold(DE3)pLysS AG']
Sequence
MQERIKACFTESIQTQIAAAEALPDAISRAAMTLVQSLLNGNKILCCGNGTSAANAQHFA
ASMINRFETERPSLPAIALNTDNVVLTAIANDRLHDEVYAKQVRALGHAGDVLLAISTRG
NSRDIVKAVEAAVTRDMTIVALTGYDGGELAGLLGPQDVEIRIPSHRSARIQEMHMLTVN
CLCDLIDNTLFPHQDD
Download sequence
Identical sequences A0A017IB68 A0A023Z3A6 A0A024KN51 A0A025CGF7 A0A026V1Y5 A0A069XS24 A0A070FC70 A0A070SX27 A0A070UXK3 A0A080IJC6 A0A090NE76 A0A0A0FG52 A0A0E0U3Q0 A0A0E1M670 A0A0E1SXC4 A0A0E2TT17 A0A0F6C9C1 A0A0F6FCL7 A0A0H3PSJ9 A0A0H8HMV2 A0A0M7N0R8 A0A0S3NQ65 A0A125WYB4 A0A127GPU4 A0A140N7G1 A0A142H722 A0A1Q8M5Z3 A0A1Q8NM93 A0A1W2MRG5 A0A1X3IHN4 A0A1X3JCV4 A0A1X3JS09 A0A1X3KHV1 A0A1X3LE76 A0A1Z3UZA5 A0A226KFH5 A0A2H1BM07 A8A4W5 B1EEX4 B1IQX2 B1XGW1 B2U2L8 B3X320 B5YS39 B6I1M4 C3SSY7 C4ZSP0 D2A871 D3QSM1 D6IE66 D7XN05 D7Y506 E1ILA3 E1J0H3 E2X7U7 E3PK61 E6BFK3 E7SIP5 E7SV64 E7T998 E9TGW7 F0JQL2 F3VAK8 F3WNB4 F4NHX3 F4SNM8 F4TJJ3 F5N7H2 F5P049 G0F756 H4UPK5 I2RZB7 I2SVK5 I2W8D4 I2X657 I4T315 I6BEU6 I6CG25 I6D386 I6DPV7 I6FKN4 I6GLP0 J7QR63 K0WUZ4 L2VGV7 L3C0Q9 L4V412 M9GAQ3 P66817 P66818 P66819 Q31W28 Q32BI3 Q3YX92 R8X4C9 S0U9E3 S0WMP8 S1D7D1 S1EVY4 S1H6P7 S1HUU7 S1IPR8 T8IYX8 T9CC28 T9SG71 U9XV49 U9XXN3 V0AAJ2 V2RRQ0 W0AWH6 W1AZ42 W1F4J7
gi|82545611|ref|YP_409558.1| gi|387622813|ref|YP_006130441.1| gi|187733918|ref|YP_001881934.1| gi|383180329|ref|YP_005458334.1| gi|170018599|ref|YP_001723553.1| gi|82778464|ref|YP_404813.1| gi|238902253|ref|YP_002928049.1| gi|251786421|ref|YP_003000725.1| gi|254795100|ref|YP_003079937.1| gi|209920626|ref|YP_002294710.1| gi|30064489|ref|NP_838660.1| NP_312057.1.58667 NP_417618.1.90541 NP_708950.1.23235 WP_001158034.1.1000 WP_001158034.1.10001 WP_001158034.1.100044 WP_001158034.1.100063 WP_001158034.1.100073 WP_001158034.1.100085 WP_001158034.1.10010 WP_001158034.1.100111 WP_001158034.1.100116 WP_001158034.1.100135 WP_001158034.1.100159 WP_001158034.1.100251 WP_001158034.1.100285 WP_001158034.1.100299 WP_001158034.1.100302 WP_001158034.1.100315 WP_001158034.1.10034 WP_001158034.1.100389 WP_001158034.1.100441 WP_001158034.1.100444 WP_001158034.1.100447 WP_001158034.1.100448 WP_001158034.1.100451 WP_001158034.1.10048 WP_001158034.1.100487 WP_001158034.1.100496 WP_001158034.1.100508 WP_001158034.1.10051 WP_001158034.1.100554 WP_001158034.1.100573 WP_001158034.1.100614 WP_001158034.1.100667 WP_001158034.1.10067 WP_001158034.1.100685 WP_001158034.1.100725 WP_001158034.1.100753 WP_001158034.1.100758 WP_001158034.1.100803 WP_001158034.1.100824 WP_001158034.1.100851 WP_001158034.1.100852 WP_001158034.1.10086 WP_001158034.1.100868 WP_001158034.1.100925 WP_001158034.1.100928 WP_001158034.1.10094 WP_001158034.1.100966 WP_001158034.1.100990 WP_001158034.1.101033 WP_001158034.1.101096 WP_001158034.1.101102 WP_001158034.1.101105 WP_001158034.1.101121 WP_001158034.1.101158 WP_001158034.1.101166 WP_001158034.1.101175 WP_001158034.1.101186 WP_001158034.1.101206 WP_001158034.1.101214 WP_001158034.1.101255 WP_001158034.1.101282 WP_001158034.1.101293 WP_001158034.1.101313 WP_001158034.1.101387 WP_001158034.1.101423 WP_001158034.1.101486 WP_001158034.1.101518 WP_001158034.1.101522 WP_001158034.1.101545 WP_001158034.1.101583 WP_001158034.1.101594 WP_001158034.1.101628 WP_001158034.1.101654 WP_001158034.1.101667 WP_001158034.1.101686 WP_001158034.1.101737 WP_001158034.1.101747 WP_001158034.1.101822 WP_001158034.1.10184 WP_001158034.1.10187 WP_001158034.1.10188 WP_001158034.1.101887 WP_001158034.1.101889 WP_001158034.1.101900 WP_001158034.1.101908 WP_001158034.1.101937 WP_001158034.1.101940 WP_001158034.1.101942 WP_001158034.1.101964 WP_001158034.1.101969 WP_001158034.1.101977 WP_001158034.1.101987 WP_001158034.1.102021 WP_001158034.1.10206 WP_001158034.1.102093 WP_001158034.1.102094 WP_001158034.1.102139 WP_001158034.1.10222 WP_001158034.1.10226 WP_001158034.1.10233 WP_001158034.1.10235 WP_001158034.1.10252 WP_001158034.1.10273 WP_001158034.1.10304 WP_001158034.1.10329 WP_001158034.1.10335 WP_001158034.1.10348 WP_001158034.1.10352 WP_001158034.1.10361 WP_001158034.1.10417 WP_001158034.1.10476 WP_001158034.1.10491 WP_001158034.1.10496 WP_001158034.1.10508 WP_001158034.1.10524 WP_001158034.1.10525 WP_001158034.1.10569 WP_001158034.1.10576 WP_001158034.1.1058 WP_001158034.1.10628 WP_001158034.1.1071 WP_001158034.1.10715 WP_001158034.1.10729 WP_001158034.1.10761 WP_001158034.1.10771 WP_001158034.1.10824 WP_001158034.1.10833 WP_001158034.1.10862 WP_001158034.1.10922 WP_001158034.1.10940 WP_001158034.1.10970 WP_001158034.1.10988 WP_001158034.1.10994 WP_001158034.1.10995 WP_001158034.1.11006 WP_001158034.1.11047 WP_001158034.1.11052 WP_001158034.1.11068 WP_001158034.1.11071 WP_001158034.1.1111 WP_001158034.1.11118 WP_001158034.1.11121 WP_001158034.1.1113 WP_001158034.1.11133 WP_001158034.1.11240 WP_001158034.1.11241 WP_001158034.1.11251 WP_001158034.1.11272 WP_001158034.1.11296 WP_001158034.1.11301 WP_001158034.1.11323 WP_001158034.1.1141 WP_001158034.1.11418 WP_001158034.1.11420 WP_001158034.1.11436 WP_001158034.1.11437 WP_001158034.1.11440 WP_001158034.1.11452 WP_001158034.1.11499 WP_001158034.1.11542 WP_001158034.1.11578 WP_001158034.1.11595 WP_001158034.1.11645 WP_001158034.1.11671 WP_001158034.1.11673 WP_001158034.1.1168 WP_001158034.1.11690 WP_001158034.1.1176 WP_001158034.1.11762 WP_001158034.1.11803 WP_001158034.1.11844 WP_001158034.1.1186 WP_001158034.1.11912 WP_001158034.1.11955 WP_001158034.1.1196 WP_001158034.1.11982 WP_001158034.1.12000 WP_001158034.1.12030 WP_001158034.1.12036 WP_001158034.1.12051 WP_001158034.1.12060 WP_001158034.1.12095 WP_001158034.1.12112 WP_001158034.1.1212 WP_001158034.1.1218 WP_001158034.1.12204 WP_001158034.1.12259 WP_001158034.1.12292 WP_001158034.1.12305 WP_001158034.1.12319 WP_001158034.1.12352 WP_001158034.1.12415 WP_001158034.1.12426 WP_001158034.1.12458 WP_001158034.1.12468 WP_001158034.1.12478 WP_001158034.1.12542 WP_001158034.1.12552 WP_001158034.1.12558 WP_001158034.1.12582 WP_001158034.1.12594 WP_001158034.1.12623 WP_001158034.1.12646 WP_001158034.1.12675 WP_001158034.1.12680 WP_001158034.1.12693 WP_001158034.1.127 WP_001158034.1.1275 WP_001158034.1.12756 WP_001158034.1.12762 WP_001158034.1.12766 WP_001158034.1.12775 WP_001158034.1.1280 WP_001158034.1.12831 WP_001158034.1.12876 WP_001158034.1.12965 WP_001158034.1.12979 WP_001158034.1.12987 WP_001158034.1.13002 WP_001158034.1.13015 WP_001158034.1.13031 WP_001158034.1.13060 WP_001158034.1.13074 WP_001158034.1.1312 WP_001158034.1.13136 WP_001158034.1.1314 WP_001158034.1.13144 WP_001158034.1.1315 WP_001158034.1.13157 WP_001158034.1.13176 WP_001158034.1.13217 WP_001158034.1.13223 WP_001158034.1.13239 WP_001158034.1.13252 WP_001158034.1.13258 WP_001158034.1.13278 WP_001158034.1.13281 WP_001158034.1.13290 WP_001158034.1.13332 WP_001158034.1.13333 WP_001158034.1.13346 WP_001158034.1.13348 WP_001158034.1.1335 WP_001158034.1.13383 WP_001158034.1.13411 WP_001158034.1.13430 WP_001158034.1.13442 WP_001158034.1.1345 WP_001158034.1.13451 WP_001158034.1.13481 WP_001158034.1.13492 WP_001158034.1.13525 WP_001158034.1.13566 WP_001158034.1.13585 WP_001158034.1.13589 WP_001158034.1.13600 WP_001158034.1.13601 WP_001158034.1.13608 WP_001158034.1.13618 WP_001158034.1.13624 WP_001158034.1.13644 WP_001158034.1.13664 WP_001158034.1.13672 WP_001158034.1.13740 WP_001158034.1.13791 WP_001158034.1.13798 WP_001158034.1.13824 WP_001158034.1.13867 WP_001158034.1.13877 WP_001158034.1.13881 WP_001158034.1.13891 WP_001158034.1.13924 WP_001158034.1.13936 WP_001158034.1.13939 WP_001158034.1.13949 WP_001158034.1.13974 WP_001158034.1.13981 WP_001158034.1.14030 WP_001158034.1.14094 WP_001158034.1.14110 WP_001158034.1.14127 WP_001158034.1.14129 WP_001158034.1.14154 WP_001158034.1.1419 WP_001158034.1.14199 WP_001158034.1.142 WP_001158034.1.14253 WP_001158034.1.14277 WP_001158034.1.14292 WP_001158034.1.14299 WP_001158034.1.14346 WP_001158034.1.1438 WP_001158034.1.1439 WP_001158034.1.14451 WP_001158034.1.14453 WP_001158034.1.14468 WP_001158034.1.14499 WP_001158034.1.14501 WP_001158034.1.14529 WP_001158034.1.14536 WP_001158034.1.14582 WP_001158034.1.14600 WP_001158034.1.14601 WP_001158034.1.1461 WP_001158034.1.14621 WP_001158034.1.14648 WP_001158034.1.14661 WP_001158034.1.14678 WP_001158034.1.14687 WP_001158034.1.1470 WP_001158034.1.14711 WP_001158034.1.14748 WP_001158034.1.14811 WP_001158034.1.14833 WP_001158034.1.1486 WP_001158034.1.14861 WP_001158034.1.14871 WP_001158034.1.14879 WP_001158034.1.14958 WP_001158034.1.14965 WP_001158034.1.14977 WP_001158034.1.14992 WP_001158034.1.15007 WP_001158034.1.15041 WP_001158034.1.15068 WP_001158034.1.1508 WP_001158034.1.15117 WP_001158034.1.1512 WP_001158034.1.15121 WP_001158034.1.15148 WP_001158034.1.15177 WP_001158034.1.15191 WP_001158034.1.15207 WP_001158034.1.15245 WP_001158034.1.15252 WP_001158034.1.15259 WP_001158034.1.15270 WP_001158034.1.15287 WP_001158034.1.153 WP_001158034.1.15332 WP_001158034.1.15356 WP_001158034.1.15377 WP_001158034.1.15416 WP_001158034.1.15453 WP_001158034.1.15464 WP_001158034.1.15503 WP_001158034.1.15521 WP_001158034.1.15527 WP_001158034.1.15538 WP_001158034.1.15565 WP_001158034.1.15583 WP_001158034.1.1559 WP_001158034.1.15600 WP_001158034.1.15620 WP_001158034.1.15626 WP_001158034.1.15645 WP_001158034.1.15702 WP_001158034.1.15707 WP_001158034.1.15740 WP_001158034.1.15747 WP_001158034.1.15762 WP_001158034.1.15767 WP_001158034.1.15768 WP_001158034.1.15771 WP_001158034.1.15782 WP_001158034.1.15791 WP_001158034.1.1580 WP_001158034.1.15809 WP_001158034.1.1588 WP_001158034.1.15894 WP_001158034.1.15945 WP_001158034.1.16015 WP_001158034.1.16042 WP_001158034.1.16075 WP_001158034.1.16086 WP_001158034.1.1609 WP_001158034.1.16102 WP_001158034.1.16111 WP_001158034.1.16133 WP_001158034.1.16154 WP_001158034.1.16179 WP_001158034.1.16183 WP_001158034.1.16188 WP_001158034.1.16222 WP_001158034.1.16270 WP_001158034.1.16272 WP_001158034.1.16294 WP_001158034.1.163 WP_001158034.1.16303 WP_001158034.1.1634 WP_001158034.1.16388 WP_001158034.1.16435 WP_001158034.1.16463 WP_001158034.1.16481 WP_001158034.1.16482 WP_001158034.1.16500 WP_001158034.1.16532 WP_001158034.1.16541 WP_001158034.1.1655 WP_001158034.1.16577 WP_001158034.1.16592 WP_001158034.1.16604 WP_001158034.1.16612 WP_001158034.1.16640 WP_001158034.1.16648 WP_001158034.1.16669 WP_001158034.1.16715 WP_001158034.1.16721 WP_001158034.1.1673 WP_001158034.1.16745 WP_001158034.1.16752 WP_001158034.1.16845 WP_001158034.1.16861 WP_001158034.1.16862 WP_001158034.1.16894 WP_001158034.1.16970 WP_001158034.1.16992 WP_001158034.1.17017 WP_001158034.1.17018 WP_001158034.1.17042 WP_001158034.1.17084 WP_001158034.1.17085 WP_001158034.1.17087 WP_001158034.1.17089 WP_001158034.1.17101 WP_001158034.1.17109 WP_001158034.1.17111 WP_001158034.1.17114 WP_001158034.1.17119 WP_001158034.1.17123 WP_001158034.1.17150 WP_001158034.1.17153 WP_001158034.1.17182 WP_001158034.1.17186 WP_001158034.1.17187 WP_001158034.1.17205 WP_001158034.1.17216 WP_001158034.1.17230 WP_001158034.1.17241 WP_001158034.1.1726 WP_001158034.1.17282 WP_001158034.1.17290 WP_001158034.1.17297 WP_001158034.1.17300 WP_001158034.1.17301 WP_001158034.1.1731 WP_001158034.1.17356 WP_001158034.1.17360 WP_001158034.1.17386 WP_001158034.1.17389 WP_001158034.1.17403 WP_001158034.1.17410 WP_001158034.1.17415 WP_001158034.1.17432 WP_001158034.1.17441 WP_001158034.1.17515 WP_001158034.1.17534 WP_001158034.1.1754 WP_001158034.1.1755 WP_001158034.1.17550 WP_001158034.1.17570 WP_001158034.1.17577 WP_001158034.1.1763 WP_001158034.1.17680 WP_001158034.1.1769 WP_001158034.1.17701 WP_001158034.1.17711 WP_001158034.1.17734 WP_001158034.1.17765 WP_001158034.1.17766 WP_001158034.1.1778 WP_001158034.1.17829 WP_001158034.1.17831 WP_001158034.1.17836 WP_001158034.1.17889 WP_001158034.1.17904 WP_001158034.1.17937 WP_001158034.1.17952 WP_001158034.1.18000 WP_001158034.1.18006 WP_001158034.1.18050 WP_001158034.1.18094 WP_001158034.1.18112 WP_001158034.1.18133 WP_001158034.1.18134 WP_001158034.1.18136 WP_001158034.1.18141 WP_001158034.1.18164 WP_001158034.1.18225 WP_001158034.1.18226 WP_001158034.1.18275 WP_001158034.1.18311 WP_001158034.1.18326 WP_001158034.1.18329 WP_001158034.1.18338 WP_001158034.1.1834 WP_001158034.1.18340 WP_001158034.1.18354 WP_001158034.1.18381 WP_001158034.1.18402 WP_001158034.1.18410 WP_001158034.1.18428 WP_001158034.1.18511 WP_001158034.1.18519 WP_001158034.1.18550 WP_001158034.1.18583 WP_001158034.1.18588 WP_001158034.1.18628 WP_001158034.1.18649 WP_001158034.1.1866 WP_001158034.1.18666 WP_001158034.1.1867 WP_001158034.1.18675 WP_001158034.1.18699 WP_001158034.1.18806 WP_001158034.1.1881 WP_001158034.1.18837 WP_001158034.1.18858 WP_001158034.1.18874 WP_001158034.1.18929 WP_001158034.1.18936 WP_001158034.1.18995 WP_001158034.1.19024 WP_001158034.1.1903 WP_001158034.1.19039 WP_001158034.1.1906 WP_001158034.1.19075 WP_001158034.1.191 WP_001158034.1.19100 WP_001158034.1.19113 WP_001158034.1.19114 WP_001158034.1.19122 WP_001158034.1.19129 WP_001158034.1.19140 WP_001158034.1.19148 WP_001158034.1.1915 WP_001158034.1.19150 WP_001158034.1.19194 WP_001158034.1.19205 WP_001158034.1.19206 WP_001158034.1.1925 WP_001158034.1.19277 WP_001158034.1.193 WP_001158034.1.19312 WP_001158034.1.19313 WP_001158034.1.19314 WP_001158034.1.19315 WP_001158034.1.19338 WP_001158034.1.19347 WP_001158034.1.19350 WP_001158034.1.19361 WP_001158034.1.19419 WP_001158034.1.19441 WP_001158034.1.19448 WP_001158034.1.19453 WP_001158034.1.19478 WP_001158034.1.19487 WP_001158034.1.19544 WP_001158034.1.19545 WP_001158034.1.19557 WP_001158034.1.19602 WP_001158034.1.19612 WP_001158034.1.1963 WP_001158034.1.19644 WP_001158034.1.19651 WP_001158034.1.19655 WP_001158034.1.19661 WP_001158034.1.19684 WP_001158034.1.19691 WP_001158034.1.19758 WP_001158034.1.19795 WP_001158034.1.1982 WP_001158034.1.19838 WP_001158034.1.19840 WP_001158034.1.19845 WP_001158034.1.19847 WP_001158034.1.19873 WP_001158034.1.19940 WP_001158034.1.19945 WP_001158034.1.19957 WP_001158034.1.19994 WP_001158034.1.20025 WP_001158034.1.2005 WP_001158034.1.20096 WP_001158034.1.20129 WP_001158034.1.20136 WP_001158034.1.2015 WP_001158034.1.20151 WP_001158034.1.20157 WP_001158034.1.20164 WP_001158034.1.20166 WP_001158034.1.20170 WP_001158034.1.20178 WP_001158034.1.20183 WP_001158034.1.20192 WP_001158034.1.20215 WP_001158034.1.2022 WP_001158034.1.20230 WP_001158034.1.20251 WP_001158034.1.20264 WP_001158034.1.20290 WP_001158034.1.20308 WP_001158034.1.20325 WP_001158034.1.20331 WP_001158034.1.20370 WP_001158034.1.20442 WP_001158034.1.20445 WP_001158034.1.20449 WP_001158034.1.20480 WP_001158034.1.20483 WP_001158034.1.20484 WP_001158034.1.20506 WP_001158034.1.20515 WP_001158034.1.20536 WP_001158034.1.20546 WP_001158034.1.20594 WP_001158034.1.20596 WP_001158034.1.20609 WP_001158034.1.2063 WP_001158034.1.20630 WP_001158034.1.20636 WP_001158034.1.20638 WP_001158034.1.20668 WP_001158034.1.20691 WP_001158034.1.20730 WP_001158034.1.20737 WP_001158034.1.20745 WP_001158034.1.20765 WP_001158034.1.20785 WP_001158034.1.20813 WP_001158034.1.20824 WP_001158034.1.20831 WP_001158034.1.20848 WP_001158034.1.20893 WP_001158034.1.20907 WP_001158034.1.2093 WP_001158034.1.2094 WP_001158034.1.20941 WP_001158034.1.20943 WP_001158034.1.20950 WP_001158034.1.20958 WP_001158034.1.20982 WP_001158034.1.20989 WP_001158034.1.2100 WP_001158034.1.21017 WP_001158034.1.21020 WP_001158034.1.21022 WP_001158034.1.21024 WP_001158034.1.21029 WP_001158034.1.21033 WP_001158034.1.21057 WP_001158034.1.21059 WP_001158034.1.21122 WP_001158034.1.21129 WP_001158034.1.2113 WP_001158034.1.21131 WP_001158034.1.21171 WP_001158034.1.21197 WP_001158034.1.21248 WP_001158034.1.21251 WP_001158034.1.21277 WP_001158034.1.21305 WP_001158034.1.21320 WP_001158034.1.2142 WP_001158034.1.21470 WP_001158034.1.21508 WP_001158034.1.2153 WP_001158034.1.2156 WP_001158034.1.21573 WP_001158034.1.21578 WP_001158034.1.21596 WP_001158034.1.21637 WP_001158034.1.2164 WP_001158034.1.21656 WP_001158034.1.21661 WP_001158034.1.21666 WP_001158034.1.21668 WP_001158034.1.21673 WP_001158034.1.21696 WP_001158034.1.21727 WP_001158034.1.21733 WP_001158034.1.21756 WP_001158034.1.21758 WP_001158034.1.21762 WP_001158034.1.21771 WP_001158034.1.21811 WP_001158034.1.21823 WP_001158034.1.21887 WP_001158034.1.21895 WP_001158034.1.21915 WP_001158034.1.21962 WP_001158034.1.22060 WP_001158034.1.22098 WP_001158034.1.22113 WP_001158034.1.22138 WP_001158034.1.2218 WP_001158034.1.22195 WP_001158034.1.22251 WP_001158034.1.22268 WP_001158034.1.22295 WP_001158034.1.22304 WP_001158034.1.22314 WP_001158034.1.2232 WP_001158034.1.22325 WP_001158034.1.22328 WP_001158034.1.22350 WP_001158034.1.22359 WP_001158034.1.22363 WP_001158034.1.22381 WP_001158034.1.22409 WP_001158034.1.22450 WP_001158034.1.22470 WP_001158034.1.22501 WP_001158034.1.22522 WP_001158034.1.22571 WP_001158034.1.22572 WP_001158034.1.22574 WP_001158034.1.22579 WP_001158034.1.22594 WP_001158034.1.22631 WP_001158034.1.22632 WP_001158034.1.22641 WP_001158034.1.22649 WP_001158034.1.22662 WP_001158034.1.22669 WP_001158034.1.22690 WP_001158034.1.22743 WP_001158034.1.22756 WP_001158034.1.22759 WP_001158034.1.22765 WP_001158034.1.22771 WP_001158034.1.22783 WP_001158034.1.22809 WP_001158034.1.22827 WP_001158034.1.22830 WP_001158034.1.22846 WP_001158034.1.22875 WP_001158034.1.22878 WP_001158034.1.22885 WP_001158034.1.22896 WP_001158034.1.22925 WP_001158034.1.22961 WP_001158034.1.22990 WP_001158034.1.2300 WP_001158034.1.23026 WP_001158034.1.23035 WP_001158034.1.23042 WP_001158034.1.23044 WP_001158034.1.23045 WP_001158034.1.23057 WP_001158034.1.23062 WP_001158034.1.23073 WP_001158034.1.23081 WP_001158034.1.23090 WP_001158034.1.23092 WP_001158034.1.23105 WP_001158034.1.23115 WP_001158034.1.23120 WP_001158034.1.23241 WP_001158034.1.2325 WP_001158034.1.23257 WP_001158034.1.23270 WP_001158034.1.23285 WP_001158034.1.23293 WP_001158034.1.23299 WP_001158034.1.23323 WP_001158034.1.23352 WP_001158034.1.23355 WP_001158034.1.23376 WP_001158034.1.23378 WP_001158034.1.23443 WP_001158034.1.23456 WP_001158034.1.23467 WP_001158034.1.23486 WP_001158034.1.23511 WP_001158034.1.2353 WP_001158034.1.23549 WP_001158034.1.23554 WP_001158034.1.23561 WP_001158034.1.23563 WP_001158034.1.23584 WP_001158034.1.2362 WP_001158034.1.23622 WP_001158034.1.23640 WP_001158034.1.23660 WP_001158034.1.23676 WP_001158034.1.23729 WP_001158034.1.23765 WP_001158034.1.23790 WP_001158034.1.23795 WP_001158034.1.23806 WP_001158034.1.23812 WP_001158034.1.23838 WP_001158034.1.23855 WP_001158034.1.2388 WP_001158034.1.23881 WP_001158034.1.23886 WP_001158034.1.23895 WP_001158034.1.23898 WP_001158034.1.23899 WP_001158034.1.23914 WP_001158034.1.23915 WP_001158034.1.23931 WP_001158034.1.23945 WP_001158034.1.2395 WP_001158034.1.23970 WP_001158034.1.23971 WP_001158034.1.23973 WP_001158034.1.23984 WP_001158034.1.24 WP_001158034.1.24051 WP_001158034.1.24058 WP_001158034.1.24068 WP_001158034.1.24070 WP_001158034.1.24089 WP_001158034.1.24120 WP_001158034.1.24122 WP_001158034.1.24124 WP_001158034.1.24170 WP_001158034.1.2418 WP_001158034.1.24194 WP_001158034.1.24233 WP_001158034.1.2428 WP_001158034.1.24283 WP_001158034.1.24290 WP_001158034.1.2430 WP_001158034.1.24304 WP_001158034.1.24316 WP_001158034.1.2433 WP_001158034.1.24341 WP_001158034.1.24362 WP_001158034.1.2437 WP_001158034.1.24374 WP_001158034.1.24473 WP_001158034.1.24483 WP_001158034.1.24485 WP_001158034.1.24499 WP_001158034.1.24533 WP_001158034.1.24547 WP_001158034.1.2456 WP_001158034.1.24560 WP_001158034.1.24570 WP_001158034.1.24583 WP_001158034.1.24616 WP_001158034.1.24634 WP_001158034.1.24693 WP_001158034.1.24695 WP_001158034.1.24753 WP_001158034.1.24783 WP_001158034.1.24791 WP_001158034.1.24799 WP_001158034.1.24849 WP_001158034.1.24854 WP_001158034.1.24870 WP_001158034.1.24876 WP_001158034.1.24899 WP_001158034.1.24902 WP_001158034.1.24929 WP_001158034.1.24946 WP_001158034.1.24960 WP_001158034.1.24968 WP_001158034.1.24981 WP_001158034.1.24982 WP_001158034.1.25038 WP_001158034.1.25039 WP_001158034.1.2504 WP_001158034.1.25042 WP_001158034.1.25050 WP_001158034.1.25060 WP_001158034.1.25076 WP_001158034.1.25082 WP_001158034.1.25085 WP_001158034.1.25088 WP_001158034.1.25126 WP_001158034.1.25141 WP_001158034.1.25183 WP_001158034.1.25201 WP_001158034.1.25203 WP_001158034.1.25289 WP_001158034.1.25305 WP_001158034.1.2531 WP_001158034.1.25312 WP_001158034.1.25324 WP_001158034.1.25346 WP_001158034.1.2537 WP_001158034.1.254 WP_001158034.1.25403 WP_001158034.1.2543 WP_001158034.1.255 WP_001158034.1.25517 WP_001158034.1.25525 WP_001158034.1.25526 WP_001158034.1.25577 WP_001158034.1.25598 WP_001158034.1.25602 WP_001158034.1.25631 WP_001158034.1.25643 WP_001158034.1.25652 WP_001158034.1.25713 WP_001158034.1.25717 WP_001158034.1.25718 WP_001158034.1.25750 WP_001158034.1.25753 WP_001158034.1.25755 WP_001158034.1.25794 WP_001158034.1.25799 WP_001158034.1.25819 WP_001158034.1.25831 WP_001158034.1.25832 WP_001158034.1.25843 WP_001158034.1.25855 WP_001158034.1.2589 WP_001158034.1.25915 WP_001158034.1.25996 WP_001158034.1.26005 WP_001158034.1.26048 WP_001158034.1.26066 WP_001158034.1.26100 WP_001158034.1.26105 WP_001158034.1.2612 WP_001158034.1.26121 WP_001158034.1.26125 WP_001158034.1.26130 WP_001158034.1.26134 WP_001158034.1.26135 WP_001158034.1.26191 WP_001158034.1.26246 WP_001158034.1.26264 WP_001158034.1.26331 WP_001158034.1.2637 WP_001158034.1.26379 WP_001158034.1.26391 WP_001158034.1.26401 WP_001158034.1.26403 WP_001158034.1.26438 WP_001158034.1.26443 WP_001158034.1.26467 WP_001158034.1.26474 WP_001158034.1.26480 WP_001158034.1.26517 WP_001158034.1.26525 WP_001158034.1.26569 WP_001158034.1.26570 WP_001158034.1.26575 WP_001158034.1.26588 WP_001158034.1.26590 WP_001158034.1.26644 WP_001158034.1.26658 WP_001158034.1.26716 WP_001158034.1.26736 WP_001158034.1.26761 WP_001158034.1.26766 WP_001158034.1.26878 WP_001158034.1.26912 WP_001158034.1.2694 WP_001158034.1.26943 WP_001158034.1.26975 WP_001158034.1.26998 WP_001158034.1.27057 WP_001158034.1.27098 WP_001158034.1.27101 WP_001158034.1.27105 WP_001158034.1.2712 WP_001158034.1.27134 WP_001158034.1.27175 WP_001158034.1.27214 WP_001158034.1.27260 WP_001158034.1.27280 WP_001158034.1.27283 WP_001158034.1.27287 WP_001158034.1.27292 WP_001158034.1.27338 WP_001158034.1.27367 WP_001158034.1.27373 WP_001158034.1.27426 WP_001158034.1.27445 WP_001158034.1.27451 WP_001158034.1.27472 WP_001158034.1.27504 WP_001158034.1.27518 WP_001158034.1.2755 WP_001158034.1.27560 WP_001158034.1.27611 WP_001158034.1.27683 WP_001158034.1.27691 WP_001158034.1.27698 WP_001158034.1.27734 WP_001158034.1.27741 WP_001158034.1.27742 WP_001158034.1.27749 WP_001158034.1.27774 WP_001158034.1.27786 WP_001158034.1.27879 WP_001158034.1.27911 WP_001158034.1.27923 WP_001158034.1.27957 WP_001158034.1.27971 WP_001158034.1.28046 WP_001158034.1.2811 WP_001158034.1.28128 WP_001158034.1.28143 WP_001158034.1.28168 WP_001158034.1.2823 WP_001158034.1.28250 WP_001158034.1.2826 WP_001158034.1.28268 WP_001158034.1.28271 WP_001158034.1.28305 WP_001158034.1.28318 WP_001158034.1.28371 WP_001158034.1.28414 WP_001158034.1.28433 WP_001158034.1.28440 WP_001158034.1.28491 WP_001158034.1.28496 WP_001158034.1.28509 WP_001158034.1.28536 WP_001158034.1.28540 WP_001158034.1.28551 WP_001158034.1.28662 WP_001158034.1.28697 WP_001158034.1.28711 WP_001158034.1.28734 WP_001158034.1.28760 WP_001158034.1.28762 WP_001158034.1.28769 WP_001158034.1.28791 WP_001158034.1.28809 WP_001158034.1.28835 WP_001158034.1.28863 WP_001158034.1.28879 WP_001158034.1.28919 WP_001158034.1.28953 WP_001158034.1.28994 WP_001158034.1.290 WP_001158034.1.29001 WP_001158034.1.29013 WP_001158034.1.29016 WP_001158034.1.29026 WP_001158034.1.29055 WP_001158034.1.29061 WP_001158034.1.29079 WP_001158034.1.291 WP_001158034.1.29100 WP_001158034.1.29126 WP_001158034.1.29128 WP_001158034.1.29146 WP_001158034.1.29176 WP_001158034.1.29194 WP_001158034.1.29197 WP_001158034.1.29202 WP_001158034.1.29221 WP_001158034.1.29230 WP_001158034.1.29239 WP_001158034.1.29252 WP_001158034.1.2926 WP_001158034.1.2931 WP_001158034.1.29404 WP_001158034.1.2942 WP_001158034.1.29429 WP_001158034.1.2945 WP_001158034.1.29495 WP_001158034.1.29556 WP_001158034.1.29564 WP_001158034.1.29597 WP_001158034.1.29618 WP_001158034.1.29643 WP_001158034.1.29683 WP_001158034.1.29689 WP_001158034.1.29699 WP_001158034.1.29724 WP_001158034.1.29740 WP_001158034.1.29746 WP_001158034.1.29752 WP_001158034.1.2978 WP_001158034.1.29818 WP_001158034.1.2986 WP_001158034.1.29893 WP_001158034.1.29933 WP_001158034.1.2995 WP_001158034.1.29967 WP_001158034.1.29976 WP_001158034.1.29992 WP_001158034.1.30 WP_001158034.1.30004 WP_001158034.1.30016 WP_001158034.1.30019 WP_001158034.1.30052 WP_001158034.1.30064 WP_001158034.1.30123 WP_001158034.1.30141 WP_001158034.1.30164 WP_001158034.1.30178 WP_001158034.1.30221 WP_001158034.1.30222 WP_001158034.1.30231 WP_001158034.1.30247 WP_001158034.1.30253 WP_001158034.1.30347 WP_001158034.1.30391 WP_001158034.1.30399 WP_001158034.1.30401 WP_001158034.1.3045 WP_001158034.1.30452 WP_001158034.1.30472 WP_001158034.1.30476 WP_001158034.1.30479 WP_001158034.1.30497 WP_001158034.1.30546 WP_001158034.1.30554 WP_001158034.1.30580 WP_001158034.1.3063 WP_001158034.1.30630 WP_001158034.1.30637 WP_001158034.1.30639 WP_001158034.1.30640 WP_001158034.1.30700 WP_001158034.1.30733 WP_001158034.1.30742 WP_001158034.1.30749 WP_001158034.1.30783 WP_001158034.1.30843 WP_001158034.1.30866 WP_001158034.1.30918 WP_001158034.1.30960 WP_001158034.1.30993 WP_001158034.1.30999 WP_001158034.1.31000 WP_001158034.1.31026 WP_001158034.1.31055 WP_001158034.1.31089 WP_001158034.1.31142 WP_001158034.1.31154 WP_001158034.1.312 WP_001158034.1.31211 WP_001158034.1.31252 WP_001158034.1.31353 WP_001158034.1.31372 WP_001158034.1.31379 WP_001158034.1.3140 WP_001158034.1.31401 WP_001158034.1.31407 WP_001158034.1.31421 WP_001158034.1.31431 WP_001158034.1.31434 WP_001158034.1.31482 WP_001158034.1.31506 WP_001158034.1.31509 WP_001158034.1.31527 WP_001158034.1.31575 WP_001158034.1.31614 WP_001158034.1.31618 WP_001158034.1.31625 WP_001158034.1.31639 WP_001158034.1.31679 WP_001158034.1.31681 WP_001158034.1.3169 WP_001158034.1.31696 WP_001158034.1.31709 WP_001158034.1.31715 WP_001158034.1.31736 WP_001158034.1.31740 WP_001158034.1.3176 WP_001158034.1.31801 WP_001158034.1.3181 WP_001158034.1.31833 WP_001158034.1.31839 WP_001158034.1.31878 WP_001158034.1.31898 WP_001158034.1.31899 WP_001158034.1.31903 WP_001158034.1.31928 WP_001158034.1.31937 WP_001158034.1.31956 WP_001158034.1.31978 WP_001158034.1.32020 WP_001158034.1.32037 WP_001158034.1.32049 WP_001158034.1.32063 WP_001158034.1.32078 WP_001158034.1.32089 WP_001158034.1.32093 WP_001158034.1.32094 WP_001158034.1.3212 WP_001158034.1.32121 WP_001158034.1.32127 WP_001158034.1.32143 WP_001158034.1.3215 WP_001158034.1.32173 WP_001158034.1.322 WP_001158034.1.32222 WP_001158034.1.32232 WP_001158034.1.32234 WP_001158034.1.32242 WP_001158034.1.32243 WP_001158034.1.32279 WP_001158034.1.3233 WP_001158034.1.32333 WP_001158034.1.32394 WP_001158034.1.32435 WP_001158034.1.32448 WP_001158034.1.32509 WP_001158034.1.32536 WP_001158034.1.32561 WP_001158034.1.32574 WP_001158034.1.32580 WP_001158034.1.32590 WP_001158034.1.32591 WP_001158034.1.32601 WP_001158034.1.32635 WP_001158034.1.32661 WP_001158034.1.32680 WP_001158034.1.327 WP_001158034.1.32715 WP_001158034.1.32720 WP_001158034.1.32722 WP_001158034.1.32724 WP_001158034.1.32741 WP_001158034.1.32811 WP_001158034.1.32815 WP_001158034.1.32888 WP_001158034.1.32903 WP_001158034.1.32910 WP_001158034.1.32931 WP_001158034.1.32946 WP_001158034.1.3295 WP_001158034.1.32959 WP_001158034.1.32972 WP_001158034.1.32984 WP_001158034.1.32992 WP_001158034.1.33004 WP_001158034.1.33014 WP_001158034.1.33018 WP_001158034.1.33022 WP_001158034.1.33049 WP_001158034.1.33053 WP_001158034.1.33055 WP_001158034.1.33094 WP_001158034.1.33119 WP_001158034.1.33125 WP_001158034.1.33146 WP_001158034.1.33167 WP_001158034.1.33171 WP_001158034.1.33178 WP_001158034.1.3323 WP_001158034.1.33237 WP_001158034.1.33238 WP_001158034.1.33244 WP_001158034.1.33268 WP_001158034.1.33325 WP_001158034.1.33362 WP_001158034.1.33385 WP_001158034.1.334 WP_001158034.1.33408 WP_001158034.1.33413 WP_001158034.1.33422 WP_001158034.1.33424 WP_001158034.1.33476 WP_001158034.1.33502 WP_001158034.1.33512 WP_001158034.1.33526 WP_001158034.1.33545 WP_001158034.1.33561 WP_001158034.1.33565 WP_001158034.1.33631 WP_001158034.1.33638 WP_001158034.1.33648 WP_001158034.1.33667 WP_001158034.1.33729 WP_001158034.1.33736 WP_001158034.1.33745 WP_001158034.1.33746 WP_001158034.1.33751 WP_001158034.1.33780 WP_001158034.1.33799 WP_001158034.1.33853 WP_001158034.1.33854 WP_001158034.1.33879 WP_001158034.1.33888 WP_001158034.1.33905 WP_001158034.1.33948 WP_001158034.1.33952 WP_001158034.1.33973 WP_001158034.1.33974 WP_001158034.1.33979 WP_001158034.1.3398 WP_001158034.1.33981 WP_001158034.1.34003 WP_001158034.1.3401 WP_001158034.1.34032 WP_001158034.1.3411 WP_001158034.1.34124 WP_001158034.1.3415 WP_001158034.1.342 WP_001158034.1.34204 WP_001158034.1.34224 WP_001158034.1.34269 WP_001158034.1.34270 WP_001158034.1.34273 WP_001158034.1.34277 WP_001158034.1.34332 WP_001158034.1.34341 WP_001158034.1.34363 WP_001158034.1.34380 WP_001158034.1.34383 WP_001158034.1.3439 WP_001158034.1.34397 WP_001158034.1.34440 WP_001158034.1.34464 WP_001158034.1.34500 WP_001158034.1.34525 WP_001158034.1.34532 WP_001158034.1.34538 WP_001158034.1.34541 WP_001158034.1.34557 WP_001158034.1.34605 WP_001158034.1.34655 WP_001158034.1.34668 WP_001158034.1.34680 WP_001158034.1.34682 WP_001158034.1.34686 WP_001158034.1.347 WP_001158034.1.34727 WP_001158034.1.34781 WP_001158034.1.34782 WP_001158034.1.34794 WP_001158034.1.34827 WP_001158034.1.34948 WP_001158034.1.34982 WP_001158034.1.34983 WP_001158034.1.34990 WP_001158034.1.34993 WP_001158034.1.35039 WP_001158034.1.3515 WP_001158034.1.35180 WP_001158034.1.35186 WP_001158034.1.35202 WP_001158034.1.35204 WP_001158034.1.3521 WP_001158034.1.35211 WP_001158034.1.35349 WP_001158034.1.35360 WP_001158034.1.35368 WP_001158034.1.35376 WP_001158034.1.35393 WP_001158034.1.35398 WP_001158034.1.35466 WP_001158034.1.3550 WP_001158034.1.35552 WP_001158034.1.35581 WP_001158034.1.3560 WP_001158034.1.35649 WP_001158034.1.35654 WP_001158034.1.35698 WP_001158034.1.35704 WP_001158034.1.35724 WP_001158034.1.35904 WP_001158034.1.3598 WP_001158034.1.35983 WP_001158034.1.36010 WP_001158034.1.36040 WP_001158034.1.36071 WP_001158034.1.36129 WP_001158034.1.36159 WP_001158034.1.36164 WP_001158034.1.36182 WP_001158034.1.3620 WP_001158034.1.36207 WP_001158034.1.36212 WP_001158034.1.36281 WP_001158034.1.36299 WP_001158034.1.36334 WP_001158034.1.36386 WP_001158034.1.36393 WP_001158034.1.36412 WP_001158034.1.36426 WP_001158034.1.36453 WP_001158034.1.36496 WP_001158034.1.36523 WP_001158034.1.36531 WP_001158034.1.36537 WP_001158034.1.36610 WP_001158034.1.36626 WP_001158034.1.36627 WP_001158034.1.36739 WP_001158034.1.36747 WP_001158034.1.36767 WP_001158034.1.36806 WP_001158034.1.36817 WP_001158034.1.36826 WP_001158034.1.36833 WP_001158034.1.36894 WP_001158034.1.36971 WP_001158034.1.37006 WP_001158034.1.37020 WP_001158034.1.37057 WP_001158034.1.37076 WP_001158034.1.37101 WP_001158034.1.37102 WP_001158034.1.37122 WP_001158034.1.37146 WP_001158034.1.37155 WP_001158034.1.3723 WP_001158034.1.37233 WP_001158034.1.37252 WP_001158034.1.37261 WP_001158034.1.3730 WP_001158034.1.37329 WP_001158034.1.37334 WP_001158034.1.37337 WP_001158034.1.37372 WP_001158034.1.37419 WP_001158034.1.37433 WP_001158034.1.37445 WP_001158034.1.37472 WP_001158034.1.37485 WP_001158034.1.3749 WP_001158034.1.37543 WP_001158034.1.37548 WP_001158034.1.37549 WP_001158034.1.37554 WP_001158034.1.37576 WP_001158034.1.37588 WP_001158034.1.3762 WP_001158034.1.37634 WP_001158034.1.37637 WP_001158034.1.37730 WP_001158034.1.37731 WP_001158034.1.37745 WP_001158034.1.37750 WP_001158034.1.37762 WP_001158034.1.37766 WP_001158034.1.37769 WP_001158034.1.37830 WP_001158034.1.37847 WP_001158034.1.3788 WP_001158034.1.37897 WP_001158034.1.37926 WP_001158034.1.37940 WP_001158034.1.3795 WP_001158034.1.37964 WP_001158034.1.37967 WP_001158034.1.38050 WP_001158034.1.38063 WP_001158034.1.38080 WP_001158034.1.38085 WP_001158034.1.38105 WP_001158034.1.38107 WP_001158034.1.3811 WP_001158034.1.38119 WP_001158034.1.3815 WP_001158034.1.38155 WP_001158034.1.38182 WP_001158034.1.38202 WP_001158034.1.38211 WP_001158034.1.3822 WP_001158034.1.38264 WP_001158034.1.38306 WP_001158034.1.38314 WP_001158034.1.38323 WP_001158034.1.38357 WP_001158034.1.38363 WP_001158034.1.38369 WP_001158034.1.38371 WP_001158034.1.38392 WP_001158034.1.38419 WP_001158034.1.38485 WP_001158034.1.38533 WP_001158034.1.38544 WP_001158034.1.38584 WP_001158034.1.38610 WP_001158034.1.38636 WP_001158034.1.38694 WP_001158034.1.38751 WP_001158034.1.38827 WP_001158034.1.38835 WP_001158034.1.38843 WP_001158034.1.38896 WP_001158034.1.389 WP_001158034.1.38920 WP_001158034.1.38935 WP_001158034.1.38950 WP_001158034.1.38956 WP_001158034.1.38958 WP_001158034.1.39015 WP_001158034.1.3903 WP_001158034.1.3904 WP_001158034.1.39063 WP_001158034.1.39111 WP_001158034.1.39150 WP_001158034.1.39155 WP_001158034.1.39157 WP_001158034.1.39164 WP_001158034.1.39167 WP_001158034.1.39171 WP_001158034.1.39180 WP_001158034.1.3921 WP_001158034.1.39249 WP_001158034.1.39268 WP_001158034.1.39286 WP_001158034.1.39310 WP_001158034.1.39342 WP_001158034.1.39356 WP_001158034.1.39358 WP_001158034.1.39365 WP_001158034.1.39367 WP_001158034.1.39373 WP_001158034.1.39415 WP_001158034.1.39430 WP_001158034.1.39468 WP_001158034.1.39481 WP_001158034.1.39541 WP_001158034.1.39564 WP_001158034.1.39580 WP_001158034.1.39594 WP_001158034.1.39601 WP_001158034.1.39606 WP_001158034.1.39607 WP_001158034.1.39636 WP_001158034.1.39646 WP_001158034.1.39709 WP_001158034.1.39715 WP_001158034.1.39730 WP_001158034.1.39758 WP_001158034.1.3980 WP_001158034.1.39820 WP_001158034.1.39822 WP_001158034.1.39829 WP_001158034.1.39870 WP_001158034.1.39938 WP_001158034.1.39961 WP_001158034.1.39966 WP_001158034.1.39992 WP_001158034.1.39998 WP_001158034.1.40013 WP_001158034.1.40016 WP_001158034.1.40088 WP_001158034.1.40113 WP_001158034.1.40121 WP_001158034.1.40159 WP_001158034.1.40183 WP_001158034.1.40192 WP_001158034.1.40212 WP_001158034.1.40218 WP_001158034.1.40234 WP_001158034.1.40238 WP_001158034.1.40298 WP_001158034.1.4030 WP_001158034.1.40315 WP_001158034.1.40317 WP_001158034.1.40319 WP_001158034.1.40389 WP_001158034.1.40391 WP_001158034.1.40445 WP_001158034.1.40499 WP_001158034.1.40502 WP_001158034.1.40509 WP_001158034.1.40524 WP_001158034.1.40548 WP_001158034.1.40549 WP_001158034.1.40596 WP_001158034.1.406 WP_001158034.1.40617 WP_001158034.1.40623 WP_001158034.1.40629 WP_001158034.1.40666 WP_001158034.1.40668 WP_001158034.1.40712 WP_001158034.1.40742 WP_001158034.1.40758 WP_001158034.1.40793 WP_001158034.1.4081 WP_001158034.1.40815 WP_001158034.1.4082 WP_001158034.1.40833 WP_001158034.1.40882 WP_001158034.1.40898 WP_001158034.1.40900 WP_001158034.1.40912 WP_001158034.1.40937 WP_001158034.1.40952 WP_001158034.1.40965 WP_001158034.1.4103 WP_001158034.1.41037 WP_001158034.1.41045 WP_001158034.1.41060 WP_001158034.1.41206 WP_001158034.1.41230 WP_001158034.1.41244 WP_001158034.1.41259 WP_001158034.1.4126 WP_001158034.1.41271 WP_001158034.1.41294 WP_001158034.1.41330 WP_001158034.1.41339 WP_001158034.1.41346 WP_001158034.1.41363 WP_001158034.1.41391 WP_001158034.1.41401 WP_001158034.1.41417 WP_001158034.1.41436 WP_001158034.1.41449 WP_001158034.1.41457 WP_001158034.1.41478 WP_001158034.1.41479 WP_001158034.1.41484 WP_001158034.1.41488 WP_001158034.1.41513 WP_001158034.1.41530 WP_001158034.1.41536 WP_001158034.1.41539 WP_001158034.1.41556 WP_001158034.1.41566 WP_001158034.1.41606 WP_001158034.1.41621 WP_001158034.1.41651 WP_001158034.1.41654 WP_001158034.1.41718 WP_001158034.1.41734 WP_001158034.1.41740 WP_001158034.1.41778 WP_001158034.1.41782 WP_001158034.1.41784 WP_001158034.1.41812 WP_001158034.1.41813 WP_001158034.1.41826 WP_001158034.1.41849 WP_001158034.1.41900 WP_001158034.1.41960 WP_001158034.1.41964 WP_001158034.1.41988 WP_001158034.1.42022 WP_001158034.1.42033 WP_001158034.1.42036 WP_001158034.1.42073 WP_001158034.1.42095 WP_001158034.1.42096 WP_001158034.1.42113 WP_001158034.1.4213 WP_001158034.1.42159 WP_001158034.1.42179 WP_001158034.1.42209 WP_001158034.1.42214 WP_001158034.1.42226 WP_001158034.1.42233 WP_001158034.1.42277 WP_001158034.1.42284 WP_001158034.1.42300 WP_001158034.1.42359 WP_001158034.1.42367 WP_001158034.1.42369 WP_001158034.1.42376 WP_001158034.1.4242 WP_001158034.1.42432 WP_001158034.1.42447 WP_001158034.1.42448 WP_001158034.1.42456 WP_001158034.1.4250 WP_001158034.1.42513 WP_001158034.1.42522 WP_001158034.1.42547 WP_001158034.1.42594 WP_001158034.1.4261 WP_001158034.1.42632 WP_001158034.1.42661 WP_001158034.1.42669 WP_001158034.1.42728 WP_001158034.1.42750 WP_001158034.1.42761 WP_001158034.1.42770 WP_001158034.1.42771 WP_001158034.1.42791 WP_001158034.1.42813 WP_001158034.1.4282 WP_001158034.1.42828 WP_001158034.1.42830 WP_001158034.1.42863 WP_001158034.1.42879 WP_001158034.1.42880 WP_001158034.1.4290 WP_001158034.1.42918 WP_001158034.1.42936 WP_001158034.1.42937 WP_001158034.1.42950 WP_001158034.1.42966 WP_001158034.1.42975 WP_001158034.1.42987 WP_001158034.1.42989 WP_001158034.1.43013 WP_001158034.1.4306 WP_001158034.1.43079 WP_001158034.1.43121 WP_001158034.1.4313 WP_001158034.1.43133 WP_001158034.1.43140 WP_001158034.1.43174 WP_001158034.1.43196 WP_001158034.1.43270 WP_001158034.1.43324 WP_001158034.1.43374 WP_001158034.1.43384 WP_001158034.1.43389 WP_001158034.1.43444 WP_001158034.1.43448 WP_001158034.1.43469 WP_001158034.1.43473 WP_001158034.1.43489 WP_001158034.1.43536 WP_001158034.1.43561 WP_001158034.1.43566 WP_001158034.1.43598 WP_001158034.1.43604 WP_001158034.1.43622 WP_001158034.1.43754 WP_001158034.1.43769 WP_001158034.1.43798 WP_001158034.1.43804 WP_001158034.1.43816 WP_001158034.1.43837 WP_001158034.1.43858 WP_001158034.1.43898 WP_001158034.1.43911 WP_001158034.1.43925 WP_001158034.1.43939 WP_001158034.1.43989 WP_001158034.1.4400 WP_001158034.1.44020 WP_001158034.1.44040 WP_001158034.1.44075 WP_001158034.1.44096 WP_001158034.1.44100 WP_001158034.1.4411 WP_001158034.1.44115 WP_001158034.1.44125 WP_001158034.1.44130 WP_001158034.1.44133 WP_001158034.1.44162 WP_001158034.1.44165 WP_001158034.1.44166 WP_001158034.1.44203 WP_001158034.1.44211 WP_001158034.1.44222 WP_001158034.1.44264 WP_001158034.1.44287 WP_001158034.1.44292 WP_001158034.1.44314 WP_001158034.1.44324 WP_001158034.1.44365 WP_001158034.1.44389 WP_001158034.1.44424 WP_001158034.1.44426 WP_001158034.1.4445 WP_001158034.1.44452 WP_001158034.1.44488 WP_001158034.1.44539 WP_001158034.1.44561 WP_001158034.1.44587 WP_001158034.1.44608 WP_001158034.1.44610 WP_001158034.1.44627 WP_001158034.1.44661 WP_001158034.1.44671 WP_001158034.1.44686 WP_001158034.1.44724 WP_001158034.1.44733 WP_001158034.1.44756 WP_001158034.1.448 WP_001158034.1.44814 WP_001158034.1.44818 WP_001158034.1.44821 WP_001158034.1.44840 WP_001158034.1.44841 WP_001158034.1.44848 WP_001158034.1.44849 WP_001158034.1.44854 WP_001158034.1.44906 WP_001158034.1.44923 WP_001158034.1.44954 WP_001158034.1.44960 WP_001158034.1.44970 WP_001158034.1.44977 WP_001158034.1.44980 WP_001158034.1.45000 WP_001158034.1.45020 WP_001158034.1.45025 WP_001158034.1.45028 WP_001158034.1.45043 WP_001158034.1.45053 WP_001158034.1.45068 WP_001158034.1.45076 WP_001158034.1.45104 WP_001158034.1.45116 WP_001158034.1.4515 WP_001158034.1.45153 WP_001158034.1.45156 WP_001158034.1.4516 WP_001158034.1.45195 WP_001158034.1.45208 WP_001158034.1.4524 WP_001158034.1.45246 WP_001158034.1.45293 WP_001158034.1.45301 WP_001158034.1.45313 WP_001158034.1.45329 WP_001158034.1.4535 WP_001158034.1.45359 WP_001158034.1.45392 WP_001158034.1.45404 WP_001158034.1.45440 WP_001158034.1.4549 WP_001158034.1.45494 WP_001158034.1.45500 WP_001158034.1.45538 WP_001158034.1.45565 WP_001158034.1.45575 WP_001158034.1.45581 WP_001158034.1.45595 WP_001158034.1.4563 WP_001158034.1.45664 WP_001158034.1.4570 WP_001158034.1.45707 WP_001158034.1.45718 WP_001158034.1.4574 WP_001158034.1.45741 WP_001158034.1.45752 WP_001158034.1.45799 WP_001158034.1.45841 WP_001158034.1.45846 WP_001158034.1.45901 WP_001158034.1.4593 WP_001158034.1.45933 WP_001158034.1.45941 WP_001158034.1.45945 WP_001158034.1.45949 WP_001158034.1.45962 WP_001158034.1.45991 WP_001158034.1.4600 WP_001158034.1.46026 WP_001158034.1.46039 WP_001158034.1.46097 WP_001158034.1.46115 WP_001158034.1.46186 WP_001158034.1.4619 WP_001158034.1.46213 WP_001158034.1.46217 WP_001158034.1.46245 WP_001158034.1.46282 WP_001158034.1.46283 WP_001158034.1.46325 WP_001158034.1.46329 WP_001158034.1.46369 WP_001158034.1.46414 WP_001158034.1.46429 WP_001158034.1.4643 WP_001158034.1.46441 WP_001158034.1.46451 WP_001158034.1.46468 WP_001158034.1.4647 WP_001158034.1.46487 WP_001158034.1.46503 WP_001158034.1.46541 WP_001158034.1.46552 WP_001158034.1.46573 WP_001158034.1.46582 WP_001158034.1.46597 WP_001158034.1.46602 WP_001158034.1.46611 WP_001158034.1.46626 WP_001158034.1.46655 WP_001158034.1.4670 WP_001158034.1.46734 WP_001158034.1.46802 WP_001158034.1.46810 WP_001158034.1.46820 WP_001158034.1.46821 WP_001158034.1.46832 WP_001158034.1.46857 WP_001158034.1.46876 WP_001158034.1.46882 WP_001158034.1.46898 WP_001158034.1.46909 WP_001158034.1.4691 WP_001158034.1.46912 WP_001158034.1.46913 WP_001158034.1.46932 WP_001158034.1.46990 WP_001158034.1.47029 WP_001158034.1.47030 WP_001158034.1.47038 WP_001158034.1.47048 WP_001158034.1.47063 WP_001158034.1.4708 WP_001158034.1.47135 WP_001158034.1.47140 WP_001158034.1.47156 WP_001158034.1.47171 WP_001158034.1.47186 WP_001158034.1.47197 WP_001158034.1.47198 WP_001158034.1.47224 WP_001158034.1.4723 WP_001158034.1.47307 WP_001158034.1.47316 WP_001158034.1.47319 WP_001158034.1.47322 WP_001158034.1.47350 WP_001158034.1.47356 WP_001158034.1.47370 WP_001158034.1.47386 WP_001158034.1.4740 WP_001158034.1.47401 WP_001158034.1.47411 WP_001158034.1.47414 WP_001158034.1.47416 WP_001158034.1.47451 WP_001158034.1.47477 WP_001158034.1.47496 WP_001158034.1.47529 WP_001158034.1.47582 WP_001158034.1.47634 WP_001158034.1.47646 WP_001158034.1.47647 WP_001158034.1.47654 WP_001158034.1.47673 WP_001158034.1.4772 WP_001158034.1.4773 WP_001158034.1.47734 WP_001158034.1.47740 WP_001158034.1.47744 WP_001158034.1.47761 WP_001158034.1.47764 WP_001158034.1.47765 WP_001158034.1.47770 WP_001158034.1.47775 WP_001158034.1.47784 WP_001158034.1.47791 WP_001158034.1.47827 WP_001158034.1.47837 WP_001158034.1.47848 WP_001158034.1.4785 WP_001158034.1.47884 WP_001158034.1.47914 WP_001158034.1.47954 WP_001158034.1.47962 WP_001158034.1.47981 WP_001158034.1.47983 WP_001158034.1.47994 WP_001158034.1.48048 WP_001158034.1.48065 WP_001158034.1.48073 WP_001158034.1.48080 WP_001158034.1.48087 WP_001158034.1.48096 WP_001158034.1.48111 WP_001158034.1.4812 WP_001158034.1.48176 WP_001158034.1.48188 WP_001158034.1.48194 WP_001158034.1.48200 WP_001158034.1.48203 WP_001158034.1.48226 WP_001158034.1.48258 WP_001158034.1.48285 WP_001158034.1.48290 WP_001158034.1.48291 WP_001158034.1.48353 WP_001158034.1.48355 WP_001158034.1.48371 WP_001158034.1.48385 WP_001158034.1.48404 WP_001158034.1.48417 WP_001158034.1.48477 WP_001158034.1.48480 WP_001158034.1.48483 WP_001158034.1.48505 WP_001158034.1.48522 WP_001158034.1.48590 WP_001158034.1.486 WP_001158034.1.48602 WP_001158034.1.48678 WP_001158034.1.48697 WP_001158034.1.4871 WP_001158034.1.48712 WP_001158034.1.48771 WP_001158034.1.48792 WP_001158034.1.48806 WP_001158034.1.48825 WP_001158034.1.48847 WP_001158034.1.48860 WP_001158034.1.48901 WP_001158034.1.48907 WP_001158034.1.48910 WP_001158034.1.48926 WP_001158034.1.48928 WP_001158034.1.48953 WP_001158034.1.48970 WP_001158034.1.48974 WP_001158034.1.49009 WP_001158034.1.49104 WP_001158034.1.49136 WP_001158034.1.49141 WP_001158034.1.49236 WP_001158034.1.49259 WP_001158034.1.49275 WP_001158034.1.4931 WP_001158034.1.49312 WP_001158034.1.49332 WP_001158034.1.49363 WP_001158034.1.49401 WP_001158034.1.49431 WP_001158034.1.49464 WP_001158034.1.49482 WP_001158034.1.49496 WP_001158034.1.49528 WP_001158034.1.4953 WP_001158034.1.49531 WP_001158034.1.49537 WP_001158034.1.49567 WP_001158034.1.49599 WP_001158034.1.49645 WP_001158034.1.49655 WP_001158034.1.49661 WP_001158034.1.49684 WP_001158034.1.497 WP_001158034.1.49722 WP_001158034.1.49733 WP_001158034.1.49740 WP_001158034.1.49747 WP_001158034.1.49768 WP_001158034.1.49771 WP_001158034.1.49777 WP_001158034.1.49823 WP_001158034.1.49879 WP_001158034.1.49883 WP_001158034.1.49900 WP_001158034.1.49902 WP_001158034.1.50006 WP_001158034.1.50008 WP_001158034.1.5003 WP_001158034.1.50078 WP_001158034.1.50098 WP_001158034.1.50110 WP_001158034.1.50136 WP_001158034.1.5017 WP_001158034.1.50196 WP_001158034.1.50230 WP_001158034.1.50266 WP_001158034.1.50273 WP_001158034.1.50278 WP_001158034.1.50304 WP_001158034.1.50329 WP_001158034.1.50345 WP_001158034.1.50353 WP_001158034.1.50358 WP_001158034.1.50366 WP_001158034.1.5037 WP_001158034.1.50380 WP_001158034.1.50381 WP_001158034.1.5040 WP_001158034.1.5041 WP_001158034.1.50412 WP_001158034.1.50446 WP_001158034.1.50452 WP_001158034.1.5046 WP_001158034.1.50539 WP_001158034.1.50548 WP_001158034.1.50549 WP_001158034.1.5056 WP_001158034.1.50564 WP_001158034.1.50579 WP_001158034.1.50586 WP_001158034.1.506 WP_001158034.1.5061 WP_001158034.1.5067 WP_001158034.1.50715 WP_001158034.1.50717 WP_001158034.1.50762 WP_001158034.1.50936 WP_001158034.1.5095 WP_001158034.1.50957 WP_001158034.1.50986 WP_001158034.1.50993 WP_001158034.1.51027 WP_001158034.1.51042 WP_001158034.1.51058 WP_001158034.1.5106 WP_001158034.1.51127 WP_001158034.1.51154 WP_001158034.1.51171 WP_001158034.1.51172 WP_001158034.1.51201 WP_001158034.1.51206 WP_001158034.1.51255 WP_001158034.1.5128 WP_001158034.1.51300 WP_001158034.1.51307 WP_001158034.1.51320 WP_001158034.1.51325 WP_001158034.1.51336 WP_001158034.1.51354 WP_001158034.1.51364 WP_001158034.1.51380 WP_001158034.1.51425 WP_001158034.1.51430 WP_001158034.1.51441 WP_001158034.1.5146 WP_001158034.1.51482 WP_001158034.1.51495 WP_001158034.1.51503 WP_001158034.1.51505 WP_001158034.1.51513 WP_001158034.1.5153 WP_001158034.1.51539 WP_001158034.1.51542 WP_001158034.1.51548 WP_001158034.1.51552 WP_001158034.1.5157 WP_001158034.1.51587 WP_001158034.1.51600 WP_001158034.1.51607 WP_001158034.1.51624 WP_001158034.1.51643 WP_001158034.1.51662 WP_001158034.1.51693 WP_001158034.1.51718 WP_001158034.1.5172 WP_001158034.1.51736 WP_001158034.1.51784 WP_001158034.1.51834 WP_001158034.1.51837 WP_001158034.1.51869 WP_001158034.1.51873 WP_001158034.1.51906 WP_001158034.1.51968 WP_001158034.1.51988 WP_001158034.1.51999 WP_001158034.1.52011 WP_001158034.1.52020 WP_001158034.1.52039 WP_001158034.1.52044 WP_001158034.1.52062 WP_001158034.1.52076 WP_001158034.1.52111 WP_001158034.1.52126 WP_001158034.1.52127 WP_001158034.1.52135 WP_001158034.1.5217 WP_001158034.1.52186 WP_001158034.1.52200 WP_001158034.1.52211 WP_001158034.1.52214 WP_001158034.1.52225 WP_001158034.1.52230 WP_001158034.1.52236 WP_001158034.1.52240 WP_001158034.1.52243 WP_001158034.1.52249 WP_001158034.1.52258 WP_001158034.1.52304 WP_001158034.1.52305 WP_001158034.1.52324 WP_001158034.1.52328 WP_001158034.1.52333 WP_001158034.1.52399 WP_001158034.1.52406 WP_001158034.1.52413 WP_001158034.1.52419 WP_001158034.1.52421 WP_001158034.1.52492 WP_001158034.1.52496 WP_001158034.1.52524 WP_001158034.1.52543 WP_001158034.1.52544 WP_001158034.1.52554 WP_001158034.1.52558 WP_001158034.1.52567 WP_001158034.1.52601 WP_001158034.1.52612 WP_001158034.1.5265 WP_001158034.1.52704 WP_001158034.1.5272 WP_001158034.1.52755 WP_001158034.1.52762 WP_001158034.1.52774 WP_001158034.1.52780 WP_001158034.1.52801 WP_001158034.1.52844 WP_001158034.1.52852 WP_001158034.1.52853 WP_001158034.1.52883 WP_001158034.1.52895 WP_001158034.1.52908 WP_001158034.1.5291 WP_001158034.1.52933 WP_001158034.1.52942 WP_001158034.1.52945 WP_001158034.1.52995 WP_001158034.1.52996 WP_001158034.1.53012 WP_001158034.1.53020 WP_001158034.1.53065 WP_001158034.1.53084 WP_001158034.1.53095 WP_001158034.1.53099 WP_001158034.1.53110 WP_001158034.1.53155 WP_001158034.1.53181 WP_001158034.1.53186 WP_001158034.1.53211 WP_001158034.1.5322 WP_001158034.1.53228 WP_001158034.1.53238 WP_001158034.1.53244 WP_001158034.1.53252 WP_001158034.1.53262 WP_001158034.1.53270 WP_001158034.1.53277 WP_001158034.1.53308 WP_001158034.1.53327 WP_001158034.1.53377 WP_001158034.1.53419 WP_001158034.1.53428 WP_001158034.1.53431 WP_001158034.1.53482 WP_001158034.1.53505 WP_001158034.1.5351 WP_001158034.1.53535 WP_001158034.1.53545 WP_001158034.1.53574 WP_001158034.1.53582 WP_001158034.1.53590 WP_001158034.1.53592 WP_001158034.1.53594 WP_001158034.1.53645 WP_001158034.1.53706 WP_001158034.1.53769 WP_001158034.1.53809 WP_001158034.1.53811 WP_001158034.1.53841 WP_001158034.1.53845 WP_001158034.1.53878 WP_001158034.1.53884 WP_001158034.1.53931 WP_001158034.1.5395 WP_001158034.1.53968 WP_001158034.1.53972 WP_001158034.1.53994 WP_001158034.1.54002 WP_001158034.1.54013 WP_001158034.1.54024 WP_001158034.1.54028 WP_001158034.1.54032 WP_001158034.1.54144 WP_001158034.1.54169 WP_001158034.1.54213 WP_001158034.1.54263 WP_001158034.1.54329 WP_001158034.1.5433 WP_001158034.1.54344 WP_001158034.1.54359 WP_001158034.1.5440 WP_001158034.1.5441 WP_001158034.1.54454 WP_001158034.1.54463 WP_001158034.1.54476 WP_001158034.1.54507 WP_001158034.1.54546 WP_001158034.1.54585 WP_001158034.1.5460 WP_001158034.1.54602 WP_001158034.1.54605 WP_001158034.1.5461 WP_001158034.1.54614 WP_001158034.1.54617 WP_001158034.1.54620 WP_001158034.1.54625 WP_001158034.1.54641 WP_001158034.1.5467 WP_001158034.1.54695 WP_001158034.1.5470 WP_001158034.1.54755 WP_001158034.1.54769 WP_001158034.1.5479 WP_001158034.1.54817 WP_001158034.1.5486 WP_001158034.1.54883 WP_001158034.1.54918 WP_001158034.1.54921 WP_001158034.1.54927 WP_001158034.1.54941 WP_001158034.1.54946 WP_001158034.1.54981 WP_001158034.1.54989 WP_001158034.1.54991 WP_001158034.1.55003 WP_001158034.1.55005 WP_001158034.1.55041 WP_001158034.1.55070 WP_001158034.1.55112 WP_001158034.1.5512 WP_001158034.1.55123 WP_001158034.1.55177 WP_001158034.1.55185 WP_001158034.1.55203 WP_001158034.1.55218 WP_001158034.1.55226 WP_001158034.1.55286 WP_001158034.1.55291 WP_001158034.1.55342 WP_001158034.1.55359 WP_001158034.1.55374 WP_001158034.1.55381 WP_001158034.1.55424 WP_001158034.1.55425 WP_001158034.1.55482 WP_001158034.1.55483 WP_001158034.1.55489 WP_001158034.1.55492 WP_001158034.1.55507 WP_001158034.1.55529 WP_001158034.1.55551 WP_001158034.1.55552 WP_001158034.1.55556 WP_001158034.1.55560 WP_001158034.1.55571 WP_001158034.1.55574 WP_001158034.1.55581 WP_001158034.1.55608 WP_001158034.1.55629 WP_001158034.1.5566 WP_001158034.1.55676 WP_001158034.1.55709 WP_001158034.1.55720 WP_001158034.1.55727 WP_001158034.1.55757 WP_001158034.1.55791 WP_001158034.1.55820 WP_001158034.1.55825 WP_001158034.1.55838 WP_001158034.1.55868 WP_001158034.1.55870 WP_001158034.1.55892 WP_001158034.1.55897 WP_001158034.1.55979 WP_001158034.1.56072 WP_001158034.1.561 WP_001158034.1.56101 WP_001158034.1.5614 WP_001158034.1.56151 WP_001158034.1.5616 WP_001158034.1.56164 WP_001158034.1.56177 WP_001158034.1.56197 WP_001158034.1.56285 WP_001158034.1.56345 WP_001158034.1.56358 WP_001158034.1.56388 WP_001158034.1.5639 WP_001158034.1.56392 WP_001158034.1.56436 WP_001158034.1.56446 WP_001158034.1.56481 WP_001158034.1.56489 WP_001158034.1.5649 WP_001158034.1.56491 WP_001158034.1.56501 WP_001158034.1.56513 WP_001158034.1.56528 WP_001158034.1.56554 WP_001158034.1.56571 WP_001158034.1.56573 WP_001158034.1.56665 WP_001158034.1.56713 WP_001158034.1.56742 WP_001158034.1.56776 WP_001158034.1.56777 WP_001158034.1.56786 WP_001158034.1.56787 WP_001158034.1.56789 WP_001158034.1.56799 WP_001158034.1.56830 WP_001158034.1.56846 WP_001158034.1.5685 WP_001158034.1.56871 WP_001158034.1.56882 WP_001158034.1.56885 WP_001158034.1.56908 WP_001158034.1.56932 WP_001158034.1.56934 WP_001158034.1.56937 WP_001158034.1.56951 WP_001158034.1.56978 WP_001158034.1.56980 WP_001158034.1.56992 WP_001158034.1.57032 WP_001158034.1.57051 WP_001158034.1.57068 WP_001158034.1.57071 WP_001158034.1.57100 WP_001158034.1.57124 WP_001158034.1.57150 WP_001158034.1.57159 WP_001158034.1.57180 WP_001158034.1.57181 WP_001158034.1.57197 WP_001158034.1.57216 WP_001158034.1.57254 WP_001158034.1.57269 WP_001158034.1.57280 WP_001158034.1.57319 WP_001158034.1.57348 WP_001158034.1.57349 WP_001158034.1.57386 WP_001158034.1.57395 WP_001158034.1.57401 WP_001158034.1.57403 WP_001158034.1.57410 WP_001158034.1.57414 WP_001158034.1.5742 WP_001158034.1.57432 WP_001158034.1.57453 WP_001158034.1.57466 WP_001158034.1.57487 WP_001158034.1.57517 WP_001158034.1.57558 WP_001158034.1.57574 WP_001158034.1.57588 WP_001158034.1.57610 WP_001158034.1.57628 WP_001158034.1.57634 WP_001158034.1.5764 WP_001158034.1.57646 WP_001158034.1.57659 WP_001158034.1.57663 WP_001158034.1.57669 WP_001158034.1.57719 WP_001158034.1.57738 WP_001158034.1.57814 WP_001158034.1.57836 WP_001158034.1.57846 WP_001158034.1.57851 WP_001158034.1.5786 WP_001158034.1.57898 WP_001158034.1.57903 WP_001158034.1.57904 WP_001158034.1.57951 WP_001158034.1.57975 WP_001158034.1.58045 WP_001158034.1.58048 WP_001158034.1.58057 WP_001158034.1.58060 WP_001158034.1.58080 WP_001158034.1.5812 WP_001158034.1.58136 WP_001158034.1.58143 WP_001158034.1.58146 WP_001158034.1.58169 WP_001158034.1.58206 WP_001158034.1.58232 WP_001158034.1.58238 WP_001158034.1.58316 WP_001158034.1.58340 WP_001158034.1.58368 WP_001158034.1.58384 WP_001158034.1.584 WP_001158034.1.58401 WP_001158034.1.58408 WP_001158034.1.5842 WP_001158034.1.58420 WP_001158034.1.58423 WP_001158034.1.58429 WP_001158034.1.58440 WP_001158034.1.58445 WP_001158034.1.58475 WP_001158034.1.58484 WP_001158034.1.58493 WP_001158034.1.58496 WP_001158034.1.58514 WP_001158034.1.5852 WP_001158034.1.58528 WP_001158034.1.58582 WP_001158034.1.58622 WP_001158034.1.58680 WP_001158034.1.58707 WP_001158034.1.58723 WP_001158034.1.58837 WP_001158034.1.58867 WP_001158034.1.58901 WP_001158034.1.58940 WP_001158034.1.58942 WP_001158034.1.58951 WP_001158034.1.58958 WP_001158034.1.58976 WP_001158034.1.59024 WP_001158034.1.59026 WP_001158034.1.59035 WP_001158034.1.59038 WP_001158034.1.59083 WP_001158034.1.59165 WP_001158034.1.59218 WP_001158034.1.59226 WP_001158034.1.59280 WP_001158034.1.59302 WP_001158034.1.59306 WP_001158034.1.59359 WP_001158034.1.59374 WP_001158034.1.59395 WP_001158034.1.59396 WP_001158034.1.59407 WP_001158034.1.59409 WP_001158034.1.59423 WP_001158034.1.59434 WP_001158034.1.59470 WP_001158034.1.59491 WP_001158034.1.59513 WP_001158034.1.59533 WP_001158034.1.59553 WP_001158034.1.59590 WP_001158034.1.59615 WP_001158034.1.59638 WP_001158034.1.5965 WP_001158034.1.59679 WP_001158034.1.59689 WP_001158034.1.597 WP_001158034.1.59730 WP_001158034.1.59733 WP_001158034.1.59756 WP_001158034.1.59781 WP_001158034.1.59823 WP_001158034.1.59836 WP_001158034.1.59838 WP_001158034.1.59855 WP_001158034.1.59858 WP_001158034.1.59877 WP_001158034.1.5990 WP_001158034.1.59905 WP_001158034.1.59912 WP_001158034.1.59914 WP_001158034.1.59931 WP_001158034.1.59932 WP_001158034.1.59959 WP_001158034.1.59989 WP_001158034.1.59998 WP_001158034.1.60005 WP_001158034.1.6002 WP_001158034.1.60023 WP_001158034.1.60031 WP_001158034.1.60042 WP_001158034.1.60043 WP_001158034.1.60067 WP_001158034.1.60117 WP_001158034.1.6013 WP_001158034.1.60151 WP_001158034.1.60186 WP_001158034.1.60228 WP_001158034.1.60246 WP_001158034.1.60304 WP_001158034.1.60342 WP_001158034.1.60343 WP_001158034.1.60374 WP_001158034.1.60443 WP_001158034.1.60453 WP_001158034.1.60457 WP_001158034.1.60461 WP_001158034.1.60477 WP_001158034.1.60498 WP_001158034.1.60505 WP_001158034.1.60550 WP_001158034.1.60555 WP_001158034.1.60559 WP_001158034.1.60567 WP_001158034.1.60570 WP_001158034.1.60576 WP_001158034.1.60599 WP_001158034.1.6061 WP_001158034.1.60613 WP_001158034.1.60614 WP_001158034.1.6064 WP_001158034.1.60644 WP_001158034.1.60647 WP_001158034.1.6066 WP_001158034.1.60671 WP_001158034.1.60684 WP_001158034.1.60717 WP_001158034.1.60744 WP_001158034.1.60761 WP_001158034.1.60771 WP_001158034.1.60784 WP_001158034.1.60805 WP_001158034.1.60816 WP_001158034.1.60826 WP_001158034.1.60832 WP_001158034.1.60847 WP_001158034.1.60872 WP_001158034.1.60895 WP_001158034.1.60901 WP_001158034.1.60921 WP_001158034.1.60925 WP_001158034.1.60927 WP_001158034.1.60935 WP_001158034.1.6094 WP_001158034.1.60974 WP_001158034.1.61005 WP_001158034.1.61008 WP_001158034.1.61035 WP_001158034.1.61039 WP_001158034.1.61046 WP_001158034.1.6106 WP_001158034.1.61096 WP_001158034.1.61097 WP_001158034.1.61099 WP_001158034.1.61102 WP_001158034.1.61108 WP_001158034.1.61148 WP_001158034.1.61170 WP_001158034.1.61181 WP_001158034.1.61183 WP_001158034.1.61186 WP_001158034.1.61223 WP_001158034.1.61225 WP_001158034.1.61241 WP_001158034.1.61253 WP_001158034.1.61268 WP_001158034.1.61292 WP_001158034.1.61362 WP_001158034.1.61373 WP_001158034.1.61496 WP_001158034.1.61505 WP_001158034.1.61517 WP_001158034.1.61524 WP_001158034.1.61551 WP_001158034.1.61608 WP_001158034.1.61612 WP_001158034.1.61623 WP_001158034.1.61636 WP_001158034.1.61643 WP_001158034.1.61663 WP_001158034.1.61703 WP_001158034.1.61718 WP_001158034.1.61758 WP_001158034.1.61772 WP_001158034.1.61779 WP_001158034.1.618 WP_001158034.1.61806 WP_001158034.1.61822 WP_001158034.1.61853 WP_001158034.1.61858 WP_001158034.1.61874 WP_001158034.1.61893 WP_001158034.1.61949 WP_001158034.1.61955 WP_001158034.1.61966 WP_001158034.1.62015 WP_001158034.1.62099 WP_001158034.1.6212 WP_001158034.1.62135 WP_001158034.1.62157 WP_001158034.1.62182 WP_001158034.1.62207 WP_001158034.1.62264 WP_001158034.1.62266 WP_001158034.1.62273 WP_001158034.1.62282 WP_001158034.1.62290 WP_001158034.1.62296 WP_001158034.1.62303 WP_001158034.1.62348 WP_001158034.1.6245 WP_001158034.1.62480 WP_001158034.1.62487 WP_001158034.1.62503 WP_001158034.1.62507 WP_001158034.1.62513 WP_001158034.1.6261 WP_001158034.1.62612 WP_001158034.1.62642 WP_001158034.1.62646 WP_001158034.1.62668 WP_001158034.1.62675 WP_001158034.1.62714 WP_001158034.1.62735 WP_001158034.1.62750 WP_001158034.1.62787 WP_001158034.1.62802 WP_001158034.1.62812 WP_001158034.1.62818 WP_001158034.1.62840 WP_001158034.1.62843 WP_001158034.1.62888 WP_001158034.1.62914 WP_001158034.1.62919 WP_001158034.1.6293 WP_001158034.1.62931 WP_001158034.1.62989 WP_001158034.1.62992 WP_001158034.1.63023 WP_001158034.1.63078 WP_001158034.1.63167 WP_001158034.1.63177 WP_001158034.1.63189 WP_001158034.1.6323 WP_001158034.1.63246 WP_001158034.1.63287 WP_001158034.1.6331 WP_001158034.1.6334 WP_001158034.1.63350 WP_001158034.1.6337 WP_001158034.1.63393 WP_001158034.1.63435 WP_001158034.1.63444 WP_001158034.1.63445 WP_001158034.1.63453 WP_001158034.1.63478 WP_001158034.1.6348 WP_001158034.1.63491 WP_001158034.1.63554 WP_001158034.1.63563 WP_001158034.1.63576 WP_001158034.1.63586 WP_001158034.1.63602 WP_001158034.1.63612 WP_001158034.1.63615 WP_001158034.1.6364 WP_001158034.1.63683 WP_001158034.1.63703 WP_001158034.1.63721 WP_001158034.1.63800 WP_001158034.1.63810 WP_001158034.1.63821 WP_001158034.1.63871 WP_001158034.1.63872 WP_001158034.1.63957 WP_001158034.1.63964 WP_001158034.1.63990 WP_001158034.1.64008 WP_001158034.1.64040 WP_001158034.1.64080 WP_001158034.1.64086 WP_001158034.1.64110 WP_001158034.1.64153 WP_001158034.1.6416 WP_001158034.1.64161 WP_001158034.1.64193 WP_001158034.1.64280 WP_001158034.1.64285 WP_001158034.1.64286 WP_001158034.1.6431 WP_001158034.1.64321 WP_001158034.1.64337 WP_001158034.1.64353 WP_001158034.1.64371 WP_001158034.1.64380 WP_001158034.1.64391 WP_001158034.1.6441 WP_001158034.1.64437 WP_001158034.1.64448 WP_001158034.1.6445 WP_001158034.1.64458 WP_001158034.1.64519 WP_001158034.1.64540 WP_001158034.1.64563 WP_001158034.1.64621 WP_001158034.1.64634 WP_001158034.1.64657 WP_001158034.1.6469 WP_001158034.1.647 WP_001158034.1.64746 WP_001158034.1.64749 WP_001158034.1.64784 WP_001158034.1.64789 WP_001158034.1.64793 WP_001158034.1.64821 WP_001158034.1.64866 WP_001158034.1.64895 WP_001158034.1.64912 WP_001158034.1.64926 WP_001158034.1.64930 WP_001158034.1.64939 WP_001158034.1.64946 WP_001158034.1.6499 WP_001158034.1.64990 WP_001158034.1.65023 WP_001158034.1.65035 WP_001158034.1.65040 WP_001158034.1.65056 WP_001158034.1.65084 WP_001158034.1.65085 WP_001158034.1.65097 WP_001158034.1.651 WP_001158034.1.6511 WP_001158034.1.65110 WP_001158034.1.65118 WP_001158034.1.65135 WP_001158034.1.6516 WP_001158034.1.65179 WP_001158034.1.65192 WP_001158034.1.65194 WP_001158034.1.65206 WP_001158034.1.65256 WP_001158034.1.65271 WP_001158034.1.65296 WP_001158034.1.65353 WP_001158034.1.65364 WP_001158034.1.6537 WP_001158034.1.65372 WP_001158034.1.65415 WP_001158034.1.65484 WP_001158034.1.65493 WP_001158034.1.6553 WP_001158034.1.65546 WP_001158034.1.65596 WP_001158034.1.6563 WP_001158034.1.65662 WP_001158034.1.65667 WP_001158034.1.65672 WP_001158034.1.65677 WP_001158034.1.65714 WP_001158034.1.6587 WP_001158034.1.65875 WP_001158034.1.65898 WP_001158034.1.65912 WP_001158034.1.65954 WP_001158034.1.65961 WP_001158034.1.65963 WP_001158034.1.65978 WP_001158034.1.65988 WP_001158034.1.66007 WP_001158034.1.66033 WP_001158034.1.6604 WP_001158034.1.66050 WP_001158034.1.66059 WP_001158034.1.6609 WP_001158034.1.66100 WP_001158034.1.66102 WP_001158034.1.66104 WP_001158034.1.66105 WP_001158034.1.66127 WP_001158034.1.66187 WP_001158034.1.66197 WP_001158034.1.6622 WP_001158034.1.66251 WP_001158034.1.66264 WP_001158034.1.66280 WP_001158034.1.66327 WP_001158034.1.66335 WP_001158034.1.6635 WP_001158034.1.66387 WP_001158034.1.66389 WP_001158034.1.66395 WP_001158034.1.66432 WP_001158034.1.66501 WP_001158034.1.66531 WP_001158034.1.6654 WP_001158034.1.66550 WP_001158034.1.66559 WP_001158034.1.66566 WP_001158034.1.66624 WP_001158034.1.66644 WP_001158034.1.6665 WP_001158034.1.66700 WP_001158034.1.66719 WP_001158034.1.66758 WP_001158034.1.6676 WP_001158034.1.66791 WP_001158034.1.66796 WP_001158034.1.66873 WP_001158034.1.66922 WP_001158034.1.66933 WP_001158034.1.66975 WP_001158034.1.66978 WP_001158034.1.6701 WP_001158034.1.67021 WP_001158034.1.67022 WP_001158034.1.67026 WP_001158034.1.67073 WP_001158034.1.67116 WP_001158034.1.67136 WP_001158034.1.67137 WP_001158034.1.67149 WP_001158034.1.67150 WP_001158034.1.67158 WP_001158034.1.67193 WP_001158034.1.67200 WP_001158034.1.67209 WP_001158034.1.67210 WP_001158034.1.67214 WP_001158034.1.67278 WP_001158034.1.67293 WP_001158034.1.6735 WP_001158034.1.67412 WP_001158034.1.67415 WP_001158034.1.67446 WP_001158034.1.67451 WP_001158034.1.67452 WP_001158034.1.67454 WP_001158034.1.67462 WP_001158034.1.67467 WP_001158034.1.67468 WP_001158034.1.67533 WP_001158034.1.67538 WP_001158034.1.67549 WP_001158034.1.67553 WP_001158034.1.67660 WP_001158034.1.67663 WP_001158034.1.67676 WP_001158034.1.6769 WP_001158034.1.67704 WP_001158034.1.67726 WP_001158034.1.67732 WP_001158034.1.67753 WP_001158034.1.67775 WP_001158034.1.67780 WP_001158034.1.67786 WP_001158034.1.67787 WP_001158034.1.67788 WP_001158034.1.67810 WP_001158034.1.67853 WP_001158034.1.67861 WP_001158034.1.67901 WP_001158034.1.67938 WP_001158034.1.67984 WP_001158034.1.67990 WP_001158034.1.67999 WP_001158034.1.68008 WP_001158034.1.68012 WP_001158034.1.68025 WP_001158034.1.6803 WP_001158034.1.68039 WP_001158034.1.68053 WP_001158034.1.68067 WP_001158034.1.68069 WP_001158034.1.68079 WP_001158034.1.68096 WP_001158034.1.68108 WP_001158034.1.68126 WP_001158034.1.6814 WP_001158034.1.68145 WP_001158034.1.68170 WP_001158034.1.68175 WP_001158034.1.68215 WP_001158034.1.68271 WP_001158034.1.68278 WP_001158034.1.68281 WP_001158034.1.68283 WP_001158034.1.68336 WP_001158034.1.68341 WP_001158034.1.68369 WP_001158034.1.68396 WP_001158034.1.68411 WP_001158034.1.68482 WP_001158034.1.68490 WP_001158034.1.68493 WP_001158034.1.68523 WP_001158034.1.68534 WP_001158034.1.68566 WP_001158034.1.68584 WP_001158034.1.68598 WP_001158034.1.68630 WP_001158034.1.68635 WP_001158034.1.68679 WP_001158034.1.68697 WP_001158034.1.68711 WP_001158034.1.68731 WP_001158034.1.68752 WP_001158034.1.6877 WP_001158034.1.68797 WP_001158034.1.6880 WP_001158034.1.68801 WP_001158034.1.68865 WP_001158034.1.6887 WP_001158034.1.68880 WP_001158034.1.68915 WP_001158034.1.6892 WP_001158034.1.68936 WP_001158034.1.68956 WP_001158034.1.68961 WP_001158034.1.6897 WP_001158034.1.68989 WP_001158034.1.69039 WP_001158034.1.69054 WP_001158034.1.69127 WP_001158034.1.69144 WP_001158034.1.6916 WP_001158034.1.6919 WP_001158034.1.69192 WP_001158034.1.6923 WP_001158034.1.69247 WP_001158034.1.69258 WP_001158034.1.69261 WP_001158034.1.6929 WP_001158034.1.69303 WP_001158034.1.69305 WP_001158034.1.69350 WP_001158034.1.69351 WP_001158034.1.694 WP_001158034.1.69404 WP_001158034.1.69441 WP_001158034.1.6945 WP_001158034.1.69473 WP_001158034.1.69537 WP_001158034.1.69551 WP_001158034.1.69583 WP_001158034.1.69589 WP_001158034.1.69593 WP_001158034.1.69596 WP_001158034.1.69646 WP_001158034.1.69649 WP_001158034.1.69655 WP_001158034.1.69730 WP_001158034.1.69780 WP_001158034.1.69803 WP_001158034.1.69810 WP_001158034.1.69818 WP_001158034.1.69868 WP_001158034.1.69896 WP_001158034.1.6993 WP_001158034.1.69979 WP_001158034.1.70081 WP_001158034.1.70123 WP_001158034.1.70125 WP_001158034.1.70149 WP_001158034.1.70190 WP_001158034.1.70191 WP_001158034.1.70200 WP_001158034.1.70251 WP_001158034.1.70256 WP_001158034.1.70264 WP_001158034.1.70299 WP_001158034.1.70341 WP_001158034.1.70370 WP_001158034.1.70407 WP_001158034.1.70477 WP_001158034.1.70492 WP_001158034.1.70509 WP_001158034.1.70517 WP_001158034.1.70530 WP_001158034.1.70539 WP_001158034.1.70576 WP_001158034.1.70592 WP_001158034.1.70600 WP_001158034.1.70619 WP_001158034.1.70656 WP_001158034.1.70694 WP_001158034.1.70698 WP_001158034.1.70705 WP_001158034.1.70713 WP_001158034.1.70723 WP_001158034.1.70728 WP_001158034.1.70747 WP_001158034.1.70767 WP_001158034.1.70787 WP_001158034.1.70794 WP_001158034.1.70803 WP_001158034.1.7090 WP_001158034.1.70900 WP_001158034.1.70952 WP_001158034.1.71003 WP_001158034.1.71024 WP_001158034.1.71037 WP_001158034.1.71099 WP_001158034.1.71149 WP_001158034.1.71158 WP_001158034.1.71159 WP_001158034.1.71170 WP_001158034.1.71176 WP_001158034.1.71192 WP_001158034.1.71199 WP_001158034.1.71205 WP_001158034.1.71221 WP_001158034.1.71223 WP_001158034.1.71225 WP_001158034.1.71226 WP_001158034.1.71229 WP_001158034.1.71264 WP_001158034.1.71269 WP_001158034.1.71272 WP_001158034.1.71273 WP_001158034.1.71285 WP_001158034.1.71312 WP_001158034.1.71315 WP_001158034.1.71323 WP_001158034.1.71327 WP_001158034.1.71354 WP_001158034.1.71397 WP_001158034.1.71403 WP_001158034.1.71405 WP_001158034.1.71409 WP_001158034.1.71423 WP_001158034.1.71448 WP_001158034.1.7147 WP_001158034.1.71480 WP_001158034.1.71522 WP_001158034.1.71533 WP_001158034.1.71537 WP_001158034.1.71540 WP_001158034.1.71560 WP_001158034.1.71603 WP_001158034.1.71632 WP_001158034.1.71690 WP_001158034.1.71695 WP_001158034.1.71724 WP_001158034.1.71767 WP_001158034.1.71783 WP_001158034.1.71832 WP_001158034.1.71837 WP_001158034.1.71840 WP_001158034.1.7192 WP_001158034.1.71922 WP_001158034.1.71938 WP_001158034.1.71940 WP_001158034.1.71944 WP_001158034.1.71945 WP_001158034.1.71975 WP_001158034.1.71987 WP_001158034.1.71993 WP_001158034.1.72016 WP_001158034.1.72033 WP_001158034.1.7205 WP_001158034.1.72054 WP_001158034.1.72090 WP_001158034.1.7210 WP_001158034.1.72120 WP_001158034.1.72126 WP_001158034.1.72153 WP_001158034.1.72155 WP_001158034.1.72157 WP_001158034.1.72180 WP_001158034.1.72184 WP_001158034.1.72237 WP_001158034.1.72240 WP_001158034.1.72261 WP_001158034.1.72262 WP_001158034.1.72279 WP_001158034.1.72293 WP_001158034.1.72322 WP_001158034.1.72342 WP_001158034.1.72362 WP_001158034.1.72391 WP_001158034.1.72392 WP_001158034.1.72397 WP_001158034.1.72414 WP_001158034.1.72427 WP_001158034.1.72431 WP_001158034.1.72449 WP_001158034.1.72511 WP_001158034.1.72521 WP_001158034.1.72535 WP_001158034.1.72537 WP_001158034.1.72544 WP_001158034.1.72574 WP_001158034.1.72582 WP_001158034.1.72593 WP_001158034.1.72606 WP_001158034.1.72614 WP_001158034.1.72615 WP_001158034.1.72641 WP_001158034.1.72643 WP_001158034.1.72651 WP_001158034.1.72652 WP_001158034.1.72663 WP_001158034.1.72694 WP_001158034.1.72698 WP_001158034.1.72725 WP_001158034.1.72729 WP_001158034.1.72738 WP_001158034.1.72745 WP_001158034.1.72747 WP_001158034.1.72748 WP_001158034.1.72758 WP_001158034.1.72764 WP_001158034.1.72778 WP_001158034.1.72804 WP_001158034.1.72806 WP_001158034.1.72860 WP_001158034.1.7291 WP_001158034.1.72910 WP_001158034.1.72913 WP_001158034.1.72947 WP_001158034.1.72956 WP_001158034.1.72998 WP_001158034.1.73015 WP_001158034.1.73085 WP_001158034.1.73126 WP_001158034.1.73129 WP_001158034.1.73193 WP_001158034.1.73217 WP_001158034.1.73230 WP_001158034.1.73243 WP_001158034.1.73251 WP_001158034.1.73278 WP_001158034.1.73292 WP_001158034.1.73295 WP_001158034.1.73340 WP_001158034.1.73343 WP_001158034.1.73349 WP_001158034.1.73385 WP_001158034.1.73393 WP_001158034.1.7349 WP_001158034.1.73498 WP_001158034.1.73524 WP_001158034.1.73565 WP_001158034.1.73592 WP_001158034.1.73604 WP_001158034.1.73626 WP_001158034.1.73631 WP_001158034.1.73652 WP_001158034.1.73717 WP_001158034.1.73743 WP_001158034.1.7376 WP_001158034.1.73785 WP_001158034.1.73801 WP_001158034.1.73807 WP_001158034.1.73811 WP_001158034.1.73827 WP_001158034.1.73835 WP_001158034.1.73843 WP_001158034.1.73844 WP_001158034.1.73859 WP_001158034.1.73897 WP_001158034.1.7392 WP_001158034.1.73934 WP_001158034.1.73942 WP_001158034.1.73968 WP_001158034.1.73980 WP_001158034.1.73992 WP_001158034.1.73996 WP_001158034.1.74051 WP_001158034.1.74053 WP_001158034.1.7411 WP_001158034.1.74123 WP_001158034.1.74184 WP_001158034.1.74213 WP_001158034.1.74223 WP_001158034.1.7424 WP_001158034.1.74243 WP_001158034.1.7425 WP_001158034.1.74251 WP_001158034.1.7429 WP_001158034.1.74294 WP_001158034.1.74309 WP_001158034.1.74365 WP_001158034.1.74423 WP_001158034.1.74445 WP_001158034.1.7446 WP_001158034.1.74465 WP_001158034.1.74509 WP_001158034.1.74513 WP_001158034.1.74520 WP_001158034.1.74521 WP_001158034.1.74528 WP_001158034.1.74536 WP_001158034.1.74557 WP_001158034.1.7461 WP_001158034.1.74624 WP_001158034.1.74625 WP_001158034.1.74670 WP_001158034.1.74687 WP_001158034.1.74691 WP_001158034.1.74705 WP_001158034.1.7471 WP_001158034.1.74713 WP_001158034.1.74716 WP_001158034.1.74720 WP_001158034.1.7475 WP_001158034.1.7479 WP_001158034.1.74793 WP_001158034.1.74811 WP_001158034.1.74828 WP_001158034.1.74854 WP_001158034.1.74860 WP_001158034.1.74867 WP_001158034.1.74873 WP_001158034.1.74879 WP_001158034.1.74904 WP_001158034.1.74914 WP_001158034.1.74975 WP_001158034.1.74993 WP_001158034.1.74998 WP_001158034.1.75003 WP_001158034.1.75029 WP_001158034.1.75030 WP_001158034.1.75124 WP_001158034.1.75138 WP_001158034.1.75139 WP_001158034.1.75143 WP_001158034.1.75145 WP_001158034.1.75149 WP_001158034.1.75155 WP_001158034.1.75164 WP_001158034.1.75209 WP_001158034.1.75219 WP_001158034.1.75221 WP_001158034.1.75243 WP_001158034.1.75247 WP_001158034.1.75248 WP_001158034.1.75270 WP_001158034.1.7536 WP_001158034.1.75367 WP_001158034.1.75382 WP_001158034.1.7539 WP_001158034.1.75428 WP_001158034.1.75491 WP_001158034.1.75505 WP_001158034.1.75507 WP_001158034.1.75515 WP_001158034.1.75529 WP_001158034.1.75536 WP_001158034.1.75537 WP_001158034.1.75568 WP_001158034.1.75577 WP_001158034.1.75594 WP_001158034.1.75602 WP_001158034.1.75612 WP_001158034.1.75653 WP_001158034.1.75672 WP_001158034.1.75679 WP_001158034.1.75687 WP_001158034.1.75694 WP_001158034.1.75696 WP_001158034.1.75698 WP_001158034.1.75735 WP_001158034.1.75758 WP_001158034.1.75767 WP_001158034.1.75803 WP_001158034.1.7583 WP_001158034.1.75922 WP_001158034.1.7597 WP_001158034.1.75983 WP_001158034.1.75989 WP_001158034.1.75995 WP_001158034.1.75999 WP_001158034.1.76005 WP_001158034.1.76039 WP_001158034.1.76054 WP_001158034.1.7608 WP_001158034.1.76087 WP_001158034.1.76089 WP_001158034.1.76118 WP_001158034.1.76152 WP_001158034.1.76184 WP_001158034.1.76189 WP_001158034.1.76196 WP_001158034.1.76211 WP_001158034.1.76312 WP_001158034.1.76325 WP_001158034.1.76361 WP_001158034.1.7637 WP_001158034.1.76376 WP_001158034.1.76384 WP_001158034.1.76387 WP_001158034.1.76390 WP_001158034.1.76407 WP_001158034.1.76446 WP_001158034.1.76447 WP_001158034.1.76448 WP_001158034.1.76452 WP_001158034.1.76460 WP_001158034.1.76462 WP_001158034.1.76466 WP_001158034.1.76477 WP_001158034.1.76544 WP_001158034.1.76547 WP_001158034.1.76562 WP_001158034.1.76595 WP_001158034.1.76612 WP_001158034.1.76697 WP_001158034.1.76701 WP_001158034.1.76705 WP_001158034.1.76707 WP_001158034.1.76712 WP_001158034.1.76815 WP_001158034.1.76827 WP_001158034.1.76840 WP_001158034.1.76884 WP_001158034.1.76909 WP_001158034.1.76918 WP_001158034.1.76933 WP_001158034.1.76948 WP_001158034.1.76957 WP_001158034.1.76965 WP_001158034.1.77015 WP_001158034.1.77099 WP_001158034.1.77120 WP_001158034.1.77128 WP_001158034.1.77173 WP_001158034.1.77175 WP_001158034.1.77198 WP_001158034.1.77214 WP_001158034.1.77239 WP_001158034.1.77255 WP_001158034.1.77275 WP_001158034.1.7728 WP_001158034.1.77284 WP_001158034.1.77288 WP_001158034.1.77291 WP_001158034.1.7731 WP_001158034.1.77326 WP_001158034.1.77341 WP_001158034.1.77358 WP_001158034.1.77391 WP_001158034.1.77392 WP_001158034.1.77448 WP_001158034.1.77452 WP_001158034.1.77470 WP_001158034.1.77471 WP_001158034.1.775 WP_001158034.1.77503 WP_001158034.1.77542 WP_001158034.1.77581 WP_001158034.1.77595 WP_001158034.1.77600 WP_001158034.1.77636 WP_001158034.1.77644 WP_001158034.1.77648 WP_001158034.1.77707 WP_001158034.1.77725 WP_001158034.1.77741 WP_001158034.1.77760 WP_001158034.1.77767 WP_001158034.1.77768 WP_001158034.1.77876 WP_001158034.1.77929 WP_001158034.1.77949 WP_001158034.1.7795 WP_001158034.1.77961 WP_001158034.1.77979 WP_001158034.1.7799 WP_001158034.1.78000 WP_001158034.1.78007 WP_001158034.1.78041 WP_001158034.1.78059 WP_001158034.1.7806 WP_001158034.1.78063 WP_001158034.1.78089 WP_001158034.1.78097 WP_001158034.1.78101 WP_001158034.1.78196 WP_001158034.1.78235 WP_001158034.1.78321 WP_001158034.1.78323 WP_001158034.1.78340 WP_001158034.1.78377 WP_001158034.1.78390 WP_001158034.1.784 WP_001158034.1.78413 WP_001158034.1.78462 WP_001158034.1.7847 WP_001158034.1.78481 WP_001158034.1.7851 WP_001158034.1.78515 WP_001158034.1.78523 WP_001158034.1.7855 WP_001158034.1.78553 WP_001158034.1.78581 WP_001158034.1.78583 WP_001158034.1.78586 WP_001158034.1.78593 WP_001158034.1.78611 WP_001158034.1.78612 WP_001158034.1.78615 WP_001158034.1.78645 WP_001158034.1.78687 WP_001158034.1.78696 WP_001158034.1.78718 WP_001158034.1.78746 WP_001158034.1.78750 WP_001158034.1.78791 WP_001158034.1.78854 WP_001158034.1.78888 WP_001158034.1.78919 WP_001158034.1.78953 WP_001158034.1.7896 WP_001158034.1.7898 WP_001158034.1.79002 WP_001158034.1.79004 WP_001158034.1.7901 WP_001158034.1.79086 WP_001158034.1.79088 WP_001158034.1.79090 WP_001158034.1.79092 WP_001158034.1.79172 WP_001158034.1.79226 WP_001158034.1.79246 WP_001158034.1.79306 WP_001158034.1.79308 WP_001158034.1.79312 WP_001158034.1.79343 WP_001158034.1.79346 WP_001158034.1.79356 WP_001158034.1.79369 WP_001158034.1.79391 WP_001158034.1.7940 WP_001158034.1.79416 WP_001158034.1.79464 WP_001158034.1.79478 WP_001158034.1.79519 WP_001158034.1.79526 WP_001158034.1.79528 WP_001158034.1.79558 WP_001158034.1.79563 WP_001158034.1.79576 WP_001158034.1.79685 WP_001158034.1.79715 WP_001158034.1.79764 WP_001158034.1.79800 WP_001158034.1.79816 WP_001158034.1.79840 WP_001158034.1.7985 WP_001158034.1.79866 WP_001158034.1.79869 WP_001158034.1.7987 WP_001158034.1.79871 WP_001158034.1.79877 WP_001158034.1.79905 WP_001158034.1.79922 WP_001158034.1.7993 WP_001158034.1.79930 WP_001158034.1.79931 WP_001158034.1.79932 WP_001158034.1.79936 WP_001158034.1.79944 WP_001158034.1.79965 WP_001158034.1.79984 WP_001158034.1.80011 WP_001158034.1.80050 WP_001158034.1.80060 WP_001158034.1.80061 WP_001158034.1.8007 WP_001158034.1.80106 WP_001158034.1.80179 WP_001158034.1.80183 WP_001158034.1.80192 WP_001158034.1.80255 WP_001158034.1.80292 WP_001158034.1.80309 WP_001158034.1.80310 WP_001158034.1.80320 WP_001158034.1.80330 WP_001158034.1.80388 WP_001158034.1.80402 WP_001158034.1.80426 WP_001158034.1.80428 WP_001158034.1.80440 WP_001158034.1.80444 WP_001158034.1.80456 WP_001158034.1.80463 WP_001158034.1.80517 WP_001158034.1.80519 WP_001158034.1.80524 WP_001158034.1.80545 WP_001158034.1.8057 WP_001158034.1.80578 WP_001158034.1.80594 WP_001158034.1.80606 WP_001158034.1.80612 WP_001158034.1.80626 WP_001158034.1.80662 WP_001158034.1.80666 WP_001158034.1.80676 WP_001158034.1.80731 WP_001158034.1.80736 WP_001158034.1.80737 WP_001158034.1.8074 WP_001158034.1.80753 WP_001158034.1.80756 WP_001158034.1.8076 WP_001158034.1.80789 WP_001158034.1.808 WP_001158034.1.80804 WP_001158034.1.80805 WP_001158034.1.80843 WP_001158034.1.80882 WP_001158034.1.80884 WP_001158034.1.8090 WP_001158034.1.8091 WP_001158034.1.80954 WP_001158034.1.80966 WP_001158034.1.80985 WP_001158034.1.81034 WP_001158034.1.81036 WP_001158034.1.81054 WP_001158034.1.81070 WP_001158034.1.81071 WP_001158034.1.81104 WP_001158034.1.81127 WP_001158034.1.81160 WP_001158034.1.81180 WP_001158034.1.81182 WP_001158034.1.8121 WP_001158034.1.81219 WP_001158034.1.81273 WP_001158034.1.81281 WP_001158034.1.81286 WP_001158034.1.8129 WP_001158034.1.81298 WP_001158034.1.81313 WP_001158034.1.81391 WP_001158034.1.81420 WP_001158034.1.81442 WP_001158034.1.81469 WP_001158034.1.81514 WP_001158034.1.8156 WP_001158034.1.81576 WP_001158034.1.81577 WP_001158034.1.81582 WP_001158034.1.81589 WP_001158034.1.81596 WP_001158034.1.81602 WP_001158034.1.81618 WP_001158034.1.81688 WP_001158034.1.81692 WP_001158034.1.81715 WP_001158034.1.8172 WP_001158034.1.81723 WP_001158034.1.81754 WP_001158034.1.81806 WP_001158034.1.81819 WP_001158034.1.81821 WP_001158034.1.81832 WP_001158034.1.81873 WP_001158034.1.81876 WP_001158034.1.81881 WP_001158034.1.81914 WP_001158034.1.81934 WP_001158034.1.81935 WP_001158034.1.81939 WP_001158034.1.81952 WP_001158034.1.81956 WP_001158034.1.81972 WP_001158034.1.81975 WP_001158034.1.82010 WP_001158034.1.82032 WP_001158034.1.82057 WP_001158034.1.82059 WP_001158034.1.82061 WP_001158034.1.82062 WP_001158034.1.82074 WP_001158034.1.82116 WP_001158034.1.82137 WP_001158034.1.82240 WP_001158034.1.82275 WP_001158034.1.82280 WP_001158034.1.82296 WP_001158034.1.82316 WP_001158034.1.82320 WP_001158034.1.82330 WP_001158034.1.8235 WP_001158034.1.82438 WP_001158034.1.82439 WP_001158034.1.82485 WP_001158034.1.82499 WP_001158034.1.82507 WP_001158034.1.82536 WP_001158034.1.82594 WP_001158034.1.82614 WP_001158034.1.82626 WP_001158034.1.82629 WP_001158034.1.82647 WP_001158034.1.82661 WP_001158034.1.8268 WP_001158034.1.82700 WP_001158034.1.82705 WP_001158034.1.82711 WP_001158034.1.82715 WP_001158034.1.82718 WP_001158034.1.82754 WP_001158034.1.82780 WP_001158034.1.82797 WP_001158034.1.82820 WP_001158034.1.82853 WP_001158034.1.82902 WP_001158034.1.83020 WP_001158034.1.83033 WP_001158034.1.83051 WP_001158034.1.8308 WP_001158034.1.83093 WP_001158034.1.83097 WP_001158034.1.83099 WP_001158034.1.831 WP_001158034.1.83140 WP_001158034.1.83144 WP_001158034.1.83160 WP_001158034.1.83177 WP_001158034.1.83205 WP_001158034.1.83224 WP_001158034.1.83286 WP_001158034.1.83321 WP_001158034.1.83330 WP_001158034.1.83340 WP_001158034.1.83384 WP_001158034.1.83415 WP_001158034.1.8345 WP_001158034.1.83466 WP_001158034.1.83537 WP_001158034.1.83544 WP_001158034.1.83564 WP_001158034.1.83584 WP_001158034.1.83706 WP_001158034.1.83712 WP_001158034.1.83735 WP_001158034.1.83762 WP_001158034.1.83781 WP_001158034.1.83807 WP_001158034.1.83820 WP_001158034.1.83941 WP_001158034.1.84004 WP_001158034.1.84074 WP_001158034.1.8411 WP_001158034.1.84164 WP_001158034.1.84172 WP_001158034.1.84185 WP_001158034.1.84210 WP_001158034.1.84219 WP_001158034.1.84264 WP_001158034.1.84298 WP_001158034.1.84312 WP_001158034.1.84313 WP_001158034.1.84331 WP_001158034.1.84339 WP_001158034.1.84405 WP_001158034.1.84410 WP_001158034.1.8444 WP_001158034.1.84462 WP_001158034.1.84467 WP_001158034.1.84482 WP_001158034.1.84518 WP_001158034.1.84534 WP_001158034.1.84584 WP_001158034.1.84635 WP_001158034.1.84657 WP_001158034.1.84668 WP_001158034.1.84675 WP_001158034.1.84738 WP_001158034.1.84740 WP_001158034.1.84768 WP_001158034.1.8477 WP_001158034.1.84797 WP_001158034.1.84841 WP_001158034.1.84850 WP_001158034.1.84875 WP_001158034.1.84877 WP_001158034.1.84878 WP_001158034.1.84893 WP_001158034.1.84916 WP_001158034.1.84929 WP_001158034.1.84948 WP_001158034.1.84966 WP_001158034.1.84972 WP_001158034.1.84977 WP_001158034.1.84986 WP_001158034.1.84989 WP_001158034.1.84990 WP_001158034.1.84994 WP_001158034.1.85002 WP_001158034.1.85008 WP_001158034.1.85052 WP_001158034.1.85085 WP_001158034.1.85090 WP_001158034.1.85098 WP_001158034.1.85105 WP_001158034.1.85112 WP_001158034.1.85129 WP_001158034.1.85141 WP_001158034.1.85155 WP_001158034.1.85156 WP_001158034.1.85216 WP_001158034.1.85247 WP_001158034.1.85253 WP_001158034.1.85255 WP_001158034.1.85260 WP_001158034.1.85305 WP_001158034.1.85310 WP_001158034.1.85323 WP_001158034.1.85369 WP_001158034.1.85385 WP_001158034.1.85416 WP_001158034.1.85435 WP_001158034.1.85500 WP_001158034.1.85546 WP_001158034.1.85558 WP_001158034.1.85563 WP_001158034.1.8560 WP_001158034.1.85601 WP_001158034.1.85621 WP_001158034.1.85685 WP_001158034.1.85722 WP_001158034.1.85752 WP_001158034.1.85767 WP_001158034.1.85772 WP_001158034.1.85773 WP_001158034.1.8579 WP_001158034.1.85793 WP_001158034.1.85800 WP_001158034.1.8582 WP_001158034.1.85857 WP_001158034.1.85895 WP_001158034.1.8592 WP_001158034.1.85948 WP_001158034.1.85969 WP_001158034.1.86 WP_001158034.1.86001 WP_001158034.1.86016 WP_001158034.1.86063 WP_001158034.1.8607 WP_001158034.1.86105 WP_001158034.1.86110 WP_001158034.1.86145 WP_001158034.1.86161 WP_001158034.1.86171 WP_001158034.1.86189 WP_001158034.1.8621 WP_001158034.1.86225 WP_001158034.1.86228 WP_001158034.1.86255 WP_001158034.1.86276 WP_001158034.1.86280 WP_001158034.1.86307 WP_001158034.1.86340 WP_001158034.1.8635 WP_001158034.1.86364 WP_001158034.1.86376 WP_001158034.1.86393 WP_001158034.1.86412 WP_001158034.1.86452 WP_001158034.1.86461 WP_001158034.1.86475 WP_001158034.1.86483 WP_001158034.1.86518 WP_001158034.1.86574 WP_001158034.1.86598 WP_001158034.1.86609 WP_001158034.1.86667 WP_001158034.1.86691 WP_001158034.1.86717 WP_001158034.1.86760 WP_001158034.1.86787 WP_001158034.1.86833 WP_001158034.1.86846 WP_001158034.1.86848 WP_001158034.1.8687 WP_001158034.1.86934 WP_001158034.1.86935 WP_001158034.1.86956 WP_001158034.1.86959 WP_001158034.1.86975 WP_001158034.1.86994 WP_001158034.1.86997 WP_001158034.1.87059 WP_001158034.1.87076 WP_001158034.1.87109 WP_001158034.1.8711 WP_001158034.1.87177 WP_001158034.1.87199 WP_001158034.1.87247 WP_001158034.1.87254 WP_001158034.1.87310 WP_001158034.1.87339 WP_001158034.1.87358 WP_001158034.1.87382 WP_001158034.1.87389 WP_001158034.1.87400 WP_001158034.1.87410 WP_001158034.1.87563 WP_001158034.1.87574 WP_001158034.1.87607 WP_001158034.1.87608 WP_001158034.1.87610 WP_001158034.1.87616 WP_001158034.1.87655 WP_001158034.1.8771 WP_001158034.1.87721 WP_001158034.1.87726 WP_001158034.1.87728 WP_001158034.1.87733 WP_001158034.1.87786 WP_001158034.1.87834 WP_001158034.1.87914 WP_001158034.1.87919 WP_001158034.1.87973 WP_001158034.1.87984 WP_001158034.1.87989 WP_001158034.1.880 WP_001158034.1.88017 WP_001158034.1.88066 WP_001158034.1.88088 WP_001158034.1.88110 WP_001158034.1.88189 WP_001158034.1.88197 WP_001158034.1.88263 WP_001158034.1.88301 WP_001158034.1.88304 WP_001158034.1.88352 WP_001158034.1.88379 WP_001158034.1.88413 WP_001158034.1.8843 WP_001158034.1.88434 WP_001158034.1.88438 WP_001158034.1.88462 WP_001158034.1.88524 WP_001158034.1.88528 WP_001158034.1.8854 WP_001158034.1.88557 WP_001158034.1.88577 WP_001158034.1.88603 WP_001158034.1.88607 WP_001158034.1.88667 WP_001158034.1.88678 WP_001158034.1.88685 WP_001158034.1.88709 WP_001158034.1.88710 WP_001158034.1.88711 WP_001158034.1.88720 WP_001158034.1.88729 WP_001158034.1.88735 WP_001158034.1.88757 WP_001158034.1.8879 WP_001158034.1.88803 WP_001158034.1.88834 WP_001158034.1.88864 WP_001158034.1.88891 WP_001158034.1.88950 WP_001158034.1.88961 WP_001158034.1.88997 WP_001158034.1.89018 WP_001158034.1.89097 WP_001158034.1.89099 WP_001158034.1.89111 WP_001158034.1.89165 WP_001158034.1.89197 WP_001158034.1.89200 WP_001158034.1.8928 WP_001158034.1.89305 WP_001158034.1.89322 WP_001158034.1.89335 WP_001158034.1.89385 WP_001158034.1.894 WP_001158034.1.89400 WP_001158034.1.89403 WP_001158034.1.89405 WP_001158034.1.89416 WP_001158034.1.89432 WP_001158034.1.8945 WP_001158034.1.89458 WP_001158034.1.89468 WP_001158034.1.89471 WP_001158034.1.89496 WP_001158034.1.89510 WP_001158034.1.89569 WP_001158034.1.89601 WP_001158034.1.89605 WP_001158034.1.89630 WP_001158034.1.89656 WP_001158034.1.89674 WP_001158034.1.89679 WP_001158034.1.89700 WP_001158034.1.89745 WP_001158034.1.89768 WP_001158034.1.89781 WP_001158034.1.89788 WP_001158034.1.89841 WP_001158034.1.8985 WP_001158034.1.89852 WP_001158034.1.89859 WP_001158034.1.89895 WP_001158034.1.89899 WP_001158034.1.89920 WP_001158034.1.89923 WP_001158034.1.89925 WP_001158034.1.89927 WP_001158034.1.89959 WP_001158034.1.89977 WP_001158034.1.89988 WP_001158034.1.89998 WP_001158034.1.90017 WP_001158034.1.90063 WP_001158034.1.90065 WP_001158034.1.90078 WP_001158034.1.9009 WP_001158034.1.90115 WP_001158034.1.90128 WP_001158034.1.90139 WP_001158034.1.90146 WP_001158034.1.90182 WP_001158034.1.90205 WP_001158034.1.90219 WP_001158034.1.90249 WP_001158034.1.90257 WP_001158034.1.90270 WP_001158034.1.90314 WP_001158034.1.90315 WP_001158034.1.90332 WP_001158034.1.90342 WP_001158034.1.90349 WP_001158034.1.90358 WP_001158034.1.9036 WP_001158034.1.90389 WP_001158034.1.90436 WP_001158034.1.90449 WP_001158034.1.90467 WP_001158034.1.90511 WP_001158034.1.90520 WP_001158034.1.90536 WP_001158034.1.9059 WP_001158034.1.90591 WP_001158034.1.9061 WP_001158034.1.90690 WP_001158034.1.90703 WP_001158034.1.90758 WP_001158034.1.90799 WP_001158034.1.90828 WP_001158034.1.90837 WP_001158034.1.90839 WP_001158034.1.9084 WP_001158034.1.90848 WP_001158034.1.90865 WP_001158034.1.90951 WP_001158034.1.90967 WP_001158034.1.9098 WP_001158034.1.90997 WP_001158034.1.91018 WP_001158034.1.91072 WP_001158034.1.91088 WP_001158034.1.91113 WP_001158034.1.91117 WP_001158034.1.91121 WP_001158034.1.91138 WP_001158034.1.91153 WP_001158034.1.91170 WP_001158034.1.9118 WP_001158034.1.91277 WP_001158034.1.91288 WP_001158034.1.91340 WP_001158034.1.91341 WP_001158034.1.91356 WP_001158034.1.91377 WP_001158034.1.91384 WP_001158034.1.91414 WP_001158034.1.91462 WP_001158034.1.91494 WP_001158034.1.915 WP_001158034.1.91526 WP_001158034.1.91548 WP_001158034.1.91551 WP_001158034.1.91594 WP_001158034.1.91630 WP_001158034.1.91640 WP_001158034.1.91643 WP_001158034.1.91651 WP_001158034.1.9168 WP_001158034.1.91685 WP_001158034.1.9169 WP_001158034.1.91701 WP_001158034.1.9171 WP_001158034.1.91739 WP_001158034.1.91777 WP_001158034.1.91779 WP_001158034.1.91793 WP_001158034.1.91801 WP_001158034.1.9185 WP_001158034.1.91850 WP_001158034.1.91863 WP_001158034.1.91871 WP_001158034.1.91879 WP_001158034.1.91894 WP_001158034.1.91951 WP_001158034.1.91994 WP_001158034.1.92005 WP_001158034.1.92014 WP_001158034.1.92019 WP_001158034.1.92029 WP_001158034.1.92031 WP_001158034.1.92058 WP_001158034.1.92114 WP_001158034.1.92123 WP_001158034.1.9215 WP_001158034.1.92161 WP_001158034.1.92180 WP_001158034.1.92195 WP_001158034.1.92215 WP_001158034.1.92224 WP_001158034.1.92304 WP_001158034.1.92323 WP_001158034.1.92361 WP_001158034.1.924 WP_001158034.1.92462 WP_001158034.1.92495 WP_001158034.1.92496 WP_001158034.1.92506 WP_001158034.1.92532 WP_001158034.1.92535 WP_001158034.1.92568 WP_001158034.1.92571 WP_001158034.1.92577 WP_001158034.1.92614 WP_001158034.1.92615 WP_001158034.1.9264 WP_001158034.1.9266 WP_001158034.1.92668 WP_001158034.1.92693 WP_001158034.1.92708 WP_001158034.1.92742 WP_001158034.1.92792 WP_001158034.1.92793 WP_001158034.1.92796 WP_001158034.1.92819 WP_001158034.1.92845 WP_001158034.1.92865 WP_001158034.1.92932 WP_001158034.1.92943 WP_001158034.1.92953 WP_001158034.1.92989 WP_001158034.1.92991 WP_001158034.1.93005 WP_001158034.1.93016 WP_001158034.1.93019 WP_001158034.1.93023 WP_001158034.1.93027 WP_001158034.1.93048 WP_001158034.1.93054 WP_001158034.1.93069 WP_001158034.1.93072 WP_001158034.1.93085 WP_001158034.1.93112 WP_001158034.1.93133 WP_001158034.1.93150 WP_001158034.1.93175 WP_001158034.1.93233 WP_001158034.1.93252 WP_001158034.1.93267 WP_001158034.1.9327 WP_001158034.1.93276 WP_001158034.1.93309 WP_001158034.1.93312 WP_001158034.1.93379 WP_001158034.1.93388 WP_001158034.1.93427 WP_001158034.1.93428 WP_001158034.1.93463 WP_001158034.1.93468 WP_001158034.1.93509 WP_001158034.1.93569 WP_001158034.1.93601 WP_001158034.1.93605 WP_001158034.1.93626 WP_001158034.1.93629 WP_001158034.1.93630 WP_001158034.1.93634 WP_001158034.1.93637 WP_001158034.1.93652 WP_001158034.1.93670 WP_001158034.1.93673 WP_001158034.1.93695 WP_001158034.1.93742 WP_001158034.1.93743 WP_001158034.1.93745 WP_001158034.1.93755 WP_001158034.1.938 WP_001158034.1.93821 WP_001158034.1.93873 WP_001158034.1.93877 WP_001158034.1.939 WP_001158034.1.93900 WP_001158034.1.93911 WP_001158034.1.93918 WP_001158034.1.93921 WP_001158034.1.93952 WP_001158034.1.93971 WP_001158034.1.94011 WP_001158034.1.94025 WP_001158034.1.94057 WP_001158034.1.94176 WP_001158034.1.94187 WP_001158034.1.94190 WP_001158034.1.94213 WP_001158034.1.9426 WP_001158034.1.94271 WP_001158034.1.94302 WP_001158034.1.94343 WP_001158034.1.94388 WP_001158034.1.94429 WP_001158034.1.94445 WP_001158034.1.94497 WP_001158034.1.94516 WP_001158034.1.94523 WP_001158034.1.94542 WP_001158034.1.94544 WP_001158034.1.94548 WP_001158034.1.9457 WP_001158034.1.94578 WP_001158034.1.94589 WP_001158034.1.94626 WP_001158034.1.94646 WP_001158034.1.94676 WP_001158034.1.94690 WP_001158034.1.94692 WP_001158034.1.94695 WP_001158034.1.94727 WP_001158034.1.94738 WP_001158034.1.94753 WP_001158034.1.94754 WP_001158034.1.94764 WP_001158034.1.94787 WP_001158034.1.94790 WP_001158034.1.948 WP_001158034.1.94801 WP_001158034.1.94806 WP_001158034.1.94836 WP_001158034.1.94877 WP_001158034.1.94880 WP_001158034.1.94889 WP_001158034.1.9489 WP_001158034.1.94898 WP_001158034.1.949 WP_001158034.1.94907 WP_001158034.1.94935 WP_001158034.1.94938 WP_001158034.1.94949 WP_001158034.1.94963 WP_001158034.1.94991 WP_001158034.1.94993 WP_001158034.1.95005 WP_001158034.1.95011 WP_001158034.1.95028 WP_001158034.1.95035 WP_001158034.1.95036 WP_001158034.1.95037 WP_001158034.1.95129 WP_001158034.1.95198 WP_001158034.1.95233 WP_001158034.1.95254 WP_001158034.1.95275 WP_001158034.1.95332 WP_001158034.1.95381 WP_001158034.1.95390 WP_001158034.1.95395 WP_001158034.1.95403 WP_001158034.1.95431 WP_001158034.1.95438 WP_001158034.1.95518 WP_001158034.1.95521 WP_001158034.1.95595 WP_001158034.1.95596 WP_001158034.1.95611 WP_001158034.1.95634 WP_001158034.1.95712 WP_001158034.1.95756 WP_001158034.1.95759 WP_001158034.1.95771 WP_001158034.1.95801 WP_001158034.1.95821 WP_001158034.1.95824 WP_001158034.1.95827 WP_001158034.1.95834 WP_001158034.1.95835 WP_001158034.1.95849 WP_001158034.1.95865 WP_001158034.1.95869 WP_001158034.1.95919 WP_001158034.1.95931 WP_001158034.1.95932 WP_001158034.1.960 WP_001158034.1.96015 WP_001158034.1.96032 WP_001158034.1.96053 WP_001158034.1.96086 WP_001158034.1.96128 WP_001158034.1.9616 WP_001158034.1.96215 WP_001158034.1.96222 WP_001158034.1.96229 WP_001158034.1.96263 WP_001158034.1.96278 WP_001158034.1.96279 WP_001158034.1.96281 WP_001158034.1.96290 WP_001158034.1.96293 WP_001158034.1.96299 WP_001158034.1.96303 WP_001158034.1.9631 WP_001158034.1.96339 WP_001158034.1.96394 WP_001158034.1.96417 WP_001158034.1.96420 WP_001158034.1.96425 WP_001158034.1.96450 WP_001158034.1.96479 WP_001158034.1.96480 WP_001158034.1.96484 WP_001158034.1.96494 WP_001158034.1.965 WP_001158034.1.96541 WP_001158034.1.9657 WP_001158034.1.96608 WP_001158034.1.96609 WP_001158034.1.96659 WP_001158034.1.96680 WP_001158034.1.96683 WP_001158034.1.96701 WP_001158034.1.96725 WP_001158034.1.96753 WP_001158034.1.96769 WP_001158034.1.96779 WP_001158034.1.96796 WP_001158034.1.96850 WP_001158034.1.9690 WP_001158034.1.96932 WP_001158034.1.96984 WP_001158034.1.96989 WP_001158034.1.97011 WP_001158034.1.97027 WP_001158034.1.97049 WP_001158034.1.97059 WP_001158034.1.9708 WP_001158034.1.97119 WP_001158034.1.97123 WP_001158034.1.97160 WP_001158034.1.97193 WP_001158034.1.97195 WP_001158034.1.97200 WP_001158034.1.97238 WP_001158034.1.97279 WP_001158034.1.9729 WP_001158034.1.97351 WP_001158034.1.97356 WP_001158034.1.97360 WP_001158034.1.9740 WP_001158034.1.97402 WP_001158034.1.97418 WP_001158034.1.97421 WP_001158034.1.97439 WP_001158034.1.97459 WP_001158034.1.9747 WP_001158034.1.97490 WP_001158034.1.97502 WP_001158034.1.97513 WP_001158034.1.97527 WP_001158034.1.97538 WP_001158034.1.97560 WP_001158034.1.97619 WP_001158034.1.97632 WP_001158034.1.97667 WP_001158034.1.97675 WP_001158034.1.97677 WP_001158034.1.9770 WP_001158034.1.97705 WP_001158034.1.97711 WP_001158034.1.97775 WP_001158034.1.97789 WP_001158034.1.97798 WP_001158034.1.97802 WP_001158034.1.97815 WP_001158034.1.97825 WP_001158034.1.97871 WP_001158034.1.97895 WP_001158034.1.97930 WP_001158034.1.97932 WP_001158034.1.97937 WP_001158034.1.97982 WP_001158034.1.97996 WP_001158034.1.98012 WP_001158034.1.98046 WP_001158034.1.98083 WP_001158034.1.981 WP_001158034.1.98115 WP_001158034.1.98155 WP_001158034.1.98176 WP_001158034.1.98187 WP_001158034.1.98202 WP_001158034.1.98205 WP_001158034.1.98208 WP_001158034.1.98220 WP_001158034.1.98235 WP_001158034.1.98241 WP_001158034.1.98244 WP_001158034.1.98279 WP_001158034.1.98284 WP_001158034.1.98312 WP_001158034.1.98323 WP_001158034.1.98355 WP_001158034.1.98384 WP_001158034.1.98404 WP_001158034.1.98424 WP_001158034.1.9844 WP_001158034.1.98442 WP_001158034.1.98451 WP_001158034.1.98477 WP_001158034.1.98498 WP_001158034.1.98543 WP_001158034.1.98569 WP_001158034.1.98578 WP_001158034.1.9858 WP_001158034.1.98587 WP_001158034.1.98603 WP_001158034.1.98614 WP_001158034.1.98628 WP_001158034.1.9864 WP_001158034.1.98641 WP_001158034.1.98654 WP_001158034.1.98668 WP_001158034.1.98683 WP_001158034.1.98776 WP_001158034.1.9883 WP_001158034.1.98849 WP_001158034.1.98886 WP_001158034.1.98908 WP_001158034.1.98920 WP_001158034.1.98976 WP_001158034.1.99053 WP_001158034.1.9907 WP_001158034.1.99101 WP_001158034.1.99110 WP_001158034.1.99119 WP_001158034.1.99182 WP_001158034.1.99209 WP_001158034.1.99234 WP_001158034.1.99265 WP_001158034.1.99292 WP_001158034.1.99295 WP_001158034.1.99310 WP_001158034.1.99319 WP_001158034.1.99345 WP_001158034.1.99392 WP_001158034.1.99400 WP_001158034.1.99427 WP_001158034.1.99446 WP_001158034.1.99453 WP_001158034.1.99471 WP_001158034.1.99486 WP_001158034.1.99487 WP_001158034.1.99501 WP_001158034.1.99534 WP_001158034.1.99562 WP_001158034.1.99602 WP_001158034.1.99603 WP_001158034.1.99641 WP_001158034.1.99692 WP_001158034.1.99774 WP_001158034.1.99791 WP_001158034.1.99804 WP_001158034.1.99827 WP_001158034.1.99891 WP_001158034.1.99912 WP_001158034.1.99929 WP_001158034.1.99986 YP_404813.1.10455 gi|384544745|ref|YP_005728809.1| gi|24114440|ref|NP_708950.1| gi|251786421|ref|YP_003000725.1| gi|387622813|ref|YP_006130441.1| gi|209398082|ref|YP_002272620.1| gi|443619223|ref|YP_007383079.1| gi|560159155|ref|YP_008851870.1| 2yva_A 2yva_B cath|current|2yvaA00/1-193 cath|current|2yvaB00/1-193 gi|16131041|ref|NP_417618.1| gi|388479144|ref|YP_491336.1| gi|157162634|ref|YP_001459952.1| gi|387613841|ref|YP_006116957.1| gi|74313686|ref|YP_312105.1| gi|386615937|ref|YP_006135603.1| APC28060 DIAA_ECOLI gi|387508554|ref|YP_006160810.1| gi|387884335|ref|YP_006314637.1| gi|254163093|ref|YP_003046201.1| gi|170082686|ref|YP_001732006.1| gi|15803691|ref|NP_289725.1| gi|253772015|ref|YP_003034846.1| gi|471334711|ref|YP_007558188.1| gi|15833284|ref|NP_312057.1| gi|291284525|ref|YP_003501343.1| 155864.Z4508 198214.SF3190 198215.S3407 300267.SDY_3328 300268.SBO_3233 300269.SSON_3295 316385.ECDH10B_3322 316407.yraO 331112.EcHS_A3341 344609.SbBS512_E3623 386585.ECs4030 409438.ECSE_3435 413997.ECB_03016 444450.ECH74115_4468 469008.ECBD_0591 481805.EcolC_0549 511145.b3149 544404.ECSP_4124 595496.BWG_2853

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]