SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|253772028|ref|YP_003034859.1| from Escherichia coli 'BL21-Gold(DE3)pLysS AG'

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|253772028|ref|YP_003034859.1|
Domain Number 1 Region: 15-373
Classification Level Classification E-value
Superfamily SIS domain 1.78e-53
Family double-SIS domain 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|253772028|ref|YP_003034859.1|
Sequence length 384
Comment sugar isomerase, AgaS family [Escherichia coli 'BL21-Gold(DE3)pLysS AG']
Sequence
MPENYTPAAAATGTWTEEEIRHQPRAWIRSLTNIDALRSALNNFLEPLLRKENLRIILTG
AGTSAFIGDIIAPWLASHTGKNFSAVPTTDLVTNPMDYLNPAHPLLLISFGRSGNSPESV
AAVELANQFVPECYHLPITCNEAGALYQNAINSDNAFALLMPAETHDRGFAMTSSITTMM
ASCLAVFAPETINSQTFRDVADRCQAILTSLGDFSEGVFGYAPWKRIVYLGSGGLQGAAR
ESALKVLELTAGKLAAFYDSPTGFRHGPKSLVDNETLVVVFVSSHPYTRQYDLDLLAELR
RDNQAMRVIAIAAESTDIVAAGPHIILPPSRHFIDVEQAFCFLMYAQTFALMQSLHMGNT
PDTPSASGTVNRVVQGVIIHPWQA
Download sequence
Identical sequences A0A026UQV9 A0A027U048 A0A028AB56 A0A028ECM5 A0A066RFH3 A0A070V9K3 A0A0A8UJB7 A0A0E0U3I6 A0A0E0XU74 A0A0E2TXN1 A0A140N5P5 A0A142H709 A0A1H0IT23 A0A1X3KYG2 A0A222QQI2 A7ZS32 B6I1L1 B7LH74 C8TXD1 C8UG95 D6I1C0 E1IL88 E9TGY2 F4NHY6 I0VVJ0 I2SWA9 I2UH08 I2W8J7 I2X190 I4T302 K4VUX0 K4Y7X0 U9Y9R4 V6FZP7 V8FHP7
gi|157159084|ref|YP_001464611.1| gi|251786408|ref|YP_003000712.1| gi|260857264|ref|YP_003231155.1| gi|407480232|ref|YP_006777381.1| gi|260869888|ref|YP_003236290.1| 331111.EcE24377A_3618 409438.ECSE_3422 413997.ECB_03003 469008.ECBD_0604 573235.ECO26_4241 585055.EC55989_3556 585395.ECO103_3883 585396.ECO111_3960 gi|260845949|ref|YP_003223727.1| gi|253772028|ref|YP_003034859.1| WP_001114873.1.1000 WP_001114873.1.100252 WP_001114873.1.100283 WP_001114873.1.100425 WP_001114873.1.100444 WP_001114873.1.100451 WP_001114873.1.100499 WP_001114873.1.100543 WP_001114873.1.100571 WP_001114873.1.100573 WP_001114873.1.100667 WP_001114873.1.10067 WP_001114873.1.10068 WP_001114873.1.100752 WP_001114873.1.100778 WP_001114873.1.100796 WP_001114873.1.10080 WP_001114873.1.100836 WP_001114873.1.10086 WP_001114873.1.100867 WP_001114873.1.100928 WP_001114873.1.100990 WP_001114873.1.101096 WP_001114873.1.101102 WP_001114873.1.101157 WP_001114873.1.101216 WP_001114873.1.101255 WP_001114873.1.101257 WP_001114873.1.101293 WP_001114873.1.101359 WP_001114873.1.101436 WP_001114873.1.101468 WP_001114873.1.101518 WP_001114873.1.10154 WP_001114873.1.101583 WP_001114873.1.101630 WP_001114873.1.101651 WP_001114873.1.101653 WP_001114873.1.101668 WP_001114873.1.10173 WP_001114873.1.101786 WP_001114873.1.101822 WP_001114873.1.10184 WP_001114873.1.101840 WP_001114873.1.101845 WP_001114873.1.101865 WP_001114873.1.10190 WP_001114873.1.101913 WP_001114873.1.101947 WP_001114873.1.101952 WP_001114873.1.101969 WP_001114873.1.101987 WP_001114873.1.102069 WP_001114873.1.102122 WP_001114873.1.10235 WP_001114873.1.10379 WP_001114873.1.10461 WP_001114873.1.10538 WP_001114873.1.10579 WP_001114873.1.1058 WP_001114873.1.10607 WP_001114873.1.10651 WP_001114873.1.1071 WP_001114873.1.1073 WP_001114873.1.1074 WP_001114873.1.10763 WP_001114873.1.10798 WP_001114873.1.10922 WP_001114873.1.10940 WP_001114873.1.10989 WP_001114873.1.10994 WP_001114873.1.11006 WP_001114873.1.11032 WP_001114873.1.11071 WP_001114873.1.11091 WP_001114873.1.11133 WP_001114873.1.112 WP_001114873.1.11524 WP_001114873.1.11578 WP_001114873.1.11616 WP_001114873.1.11699 WP_001114873.1.11748 WP_001114873.1.11759 WP_001114873.1.1186 WP_001114873.1.11949 WP_001114873.1.11985 WP_001114873.1.12030 WP_001114873.1.12051 WP_001114873.1.12060 WP_001114873.1.12279 WP_001114873.1.12320 WP_001114873.1.12344 WP_001114873.1.1242 WP_001114873.1.12478 WP_001114873.1.12566 WP_001114873.1.12645 WP_001114873.1.12743 WP_001114873.1.12749 WP_001114873.1.1275 WP_001114873.1.12762 WP_001114873.1.12781 WP_001114873.1.12831 WP_001114873.1.12876 WP_001114873.1.12911 WP_001114873.1.1295 WP_001114873.1.13002 WP_001114873.1.1315 WP_001114873.1.13222 WP_001114873.1.13301 WP_001114873.1.1335 WP_001114873.1.13437 WP_001114873.1.13451 WP_001114873.1.13492 WP_001114873.1.13525 WP_001114873.1.13601 WP_001114873.1.13924 WP_001114873.1.14058 WP_001114873.1.14304 WP_001114873.1.14417 WP_001114873.1.14432 WP_001114873.1.14493 WP_001114873.1.14582 WP_001114873.1.14601 WP_001114873.1.14672 WP_001114873.1.14678 WP_001114873.1.14693 WP_001114873.1.14993 WP_001114873.1.15041 WP_001114873.1.15087 WP_001114873.1.15138 WP_001114873.1.15193 WP_001114873.1.1524 WP_001114873.1.15270 WP_001114873.1.15300 WP_001114873.1.15332 WP_001114873.1.15335 WP_001114873.1.15377 WP_001114873.1.15416 WP_001114873.1.1543 WP_001114873.1.15444 WP_001114873.1.15464 WP_001114873.1.15528 WP_001114873.1.15583 WP_001114873.1.15593 WP_001114873.1.1561 WP_001114873.1.15752 WP_001114873.1.15791 WP_001114873.1.15809 WP_001114873.1.1582 WP_001114873.1.15916 WP_001114873.1.15945 WP_001114873.1.15983 WP_001114873.1.16171 WP_001114873.1.16183 WP_001114873.1.16194 WP_001114873.1.1621 WP_001114873.1.163 WP_001114873.1.16388 WP_001114873.1.1640 WP_001114873.1.16517 WP_001114873.1.16539 WP_001114873.1.16648 WP_001114873.1.16745 WP_001114873.1.16805 WP_001114873.1.16861 WP_001114873.1.17109 WP_001114873.1.17172 WP_001114873.1.17182 WP_001114873.1.17241 WP_001114873.1.17242 WP_001114873.1.17267 WP_001114873.1.17297 WP_001114873.1.17356 WP_001114873.1.17360 WP_001114873.1.17403 WP_001114873.1.17417 WP_001114873.1.17464 WP_001114873.1.17550 WP_001114873.1.17595 WP_001114873.1.17623 WP_001114873.1.17637 WP_001114873.1.1766 WP_001114873.1.1769 WP_001114873.1.17766 WP_001114873.1.17802 WP_001114873.1.17829 WP_001114873.1.17961 WP_001114873.1.17963 WP_001114873.1.17984 WP_001114873.1.18000 WP_001114873.1.18094 WP_001114873.1.18164 WP_001114873.1.18338 WP_001114873.1.18410 WP_001114873.1.18436 WP_001114873.1.18438 WP_001114873.1.1844 WP_001114873.1.18458 WP_001114873.1.18482 WP_001114873.1.18588 WP_001114873.1.1866 WP_001114873.1.18666 WP_001114873.1.18714 WP_001114873.1.188 WP_001114873.1.18861 WP_001114873.1.18874 WP_001114873.1.18923 WP_001114873.1.18929 WP_001114873.1.18936 WP_001114873.1.1906 WP_001114873.1.19147 WP_001114873.1.19297 WP_001114873.1.19312 WP_001114873.1.19314 WP_001114873.1.19332 WP_001114873.1.19389 WP_001114873.1.19424 WP_001114873.1.19448 WP_001114873.1.19494 WP_001114873.1.19557 WP_001114873.1.19581 WP_001114873.1.19583 WP_001114873.1.19684 WP_001114873.1.20159 WP_001114873.1.20166 WP_001114873.1.20251 WP_001114873.1.20325 WP_001114873.1.20334 WP_001114873.1.20483 WP_001114873.1.20662 WP_001114873.1.20730 WP_001114873.1.20785 WP_001114873.1.20824 WP_001114873.1.20848 WP_001114873.1.2094 WP_001114873.1.21017 WP_001114873.1.21041 WP_001114873.1.21137 WP_001114873.1.21441 WP_001114873.1.21519 WP_001114873.1.21596 WP_001114873.1.21656 WP_001114873.1.21667 WP_001114873.1.21696 WP_001114873.1.21732 WP_001114873.1.21812 WP_001114873.1.21887 WP_001114873.1.21948 WP_001114873.1.22138 WP_001114873.1.22204 WP_001114873.1.22291 WP_001114873.1.22544 WP_001114873.1.22599 WP_001114873.1.22631 WP_001114873.1.22662 WP_001114873.1.22777 WP_001114873.1.22868 WP_001114873.1.22908 WP_001114873.1.2300 WP_001114873.1.23005 WP_001114873.1.23026 WP_001114873.1.23035 WP_001114873.1.23078 WP_001114873.1.23092 WP_001114873.1.23383 WP_001114873.1.23393 WP_001114873.1.23486 WP_001114873.1.23487 WP_001114873.1.23520 WP_001114873.1.23527 WP_001114873.1.23593 WP_001114873.1.23693 WP_001114873.1.23741 WP_001114873.1.23754 WP_001114873.1.23915 WP_001114873.1.23950 WP_001114873.1.24024 WP_001114873.1.24068 WP_001114873.1.24136 WP_001114873.1.2430 WP_001114873.1.24316 WP_001114873.1.24374 WP_001114873.1.24381 WP_001114873.1.24460 WP_001114873.1.24473 WP_001114873.1.24483 WP_001114873.1.24575 WP_001114873.1.24642 WP_001114873.1.24646 WP_001114873.1.24650 WP_001114873.1.24695 WP_001114873.1.2479 WP_001114873.1.24876 WP_001114873.1.24929 WP_001114873.1.24939 WP_001114873.1.24946 WP_001114873.1.24984 WP_001114873.1.25039 WP_001114873.1.2504 WP_001114873.1.25312 WP_001114873.1.25378 WP_001114873.1.25414 WP_001114873.1.25548 WP_001114873.1.25592 WP_001114873.1.25613 WP_001114873.1.25755 WP_001114873.1.25886 WP_001114873.1.25945 WP_001114873.1.26061 WP_001114873.1.26130 WP_001114873.1.26150 WP_001114873.1.26161 WP_001114873.1.26186 WP_001114873.1.26264 WP_001114873.1.26270 WP_001114873.1.26325 WP_001114873.1.26331 WP_001114873.1.2637 WP_001114873.1.2642 WP_001114873.1.26613 WP_001114873.1.26683 WP_001114873.1.26716 WP_001114873.1.26912 WP_001114873.1.26943 WP_001114873.1.27019 WP_001114873.1.27060 WP_001114873.1.27148 WP_001114873.1.27234 WP_001114873.1.2731 WP_001114873.1.27424 WP_001114873.1.27524 WP_001114873.1.27611 WP_001114873.1.27691 WP_001114873.1.27698 WP_001114873.1.27741 WP_001114873.1.27758 WP_001114873.1.27856 WP_001114873.1.27876 WP_001114873.1.27897 WP_001114873.1.28109 WP_001114873.1.28250 WP_001114873.1.2826 WP_001114873.1.28401 WP_001114873.1.28523 WP_001114873.1.28540 WP_001114873.1.28554 WP_001114873.1.28683 WP_001114873.1.28760 WP_001114873.1.2881 WP_001114873.1.28950 WP_001114873.1.28953 WP_001114873.1.29001 WP_001114873.1.29016 WP_001114873.1.29055 WP_001114873.1.29082 WP_001114873.1.29125 WP_001114873.1.29176 WP_001114873.1.29194 WP_001114873.1.29202 WP_001114873.1.29206 WP_001114873.1.29495 WP_001114873.1.29503 WP_001114873.1.29504 WP_001114873.1.2954 WP_001114873.1.29669 WP_001114873.1.29724 WP_001114873.1.29798 WP_001114873.1.29812 WP_001114873.1.29840 WP_001114873.1.29874 WP_001114873.1.29876 WP_001114873.1.2995 WP_001114873.1.29967 WP_001114873.1.30004 WP_001114873.1.30035 WP_001114873.1.30098 WP_001114873.1.30105 WP_001114873.1.30123 WP_001114873.1.30399 WP_001114873.1.30452 WP_001114873.1.30733 WP_001114873.1.30853 WP_001114873.1.30906 WP_001114873.1.31009 WP_001114873.1.31295 WP_001114873.1.31340 WP_001114873.1.31347 WP_001114873.1.31357 WP_001114873.1.31419 WP_001114873.1.31429 WP_001114873.1.31506 WP_001114873.1.31518 WP_001114873.1.31521 WP_001114873.1.31681 WP_001114873.1.31709 WP_001114873.1.31740 WP_001114873.1.31803 WP_001114873.1.31835 WP_001114873.1.31866 WP_001114873.1.31898 WP_001114873.1.31924 WP_001114873.1.32020 WP_001114873.1.32037 WP_001114873.1.32089 WP_001114873.1.32091 WP_001114873.1.32142 WP_001114873.1.32184 WP_001114873.1.32232 WP_001114873.1.32234 WP_001114873.1.32406 WP_001114873.1.3247 WP_001114873.1.32475 WP_001114873.1.32494 WP_001114873.1.32561 WP_001114873.1.32601 WP_001114873.1.32655 WP_001114873.1.32680 WP_001114873.1.32724 WP_001114873.1.32811 WP_001114873.1.32831 WP_001114873.1.32835 WP_001114873.1.32910 WP_001114873.1.32946 WP_001114873.1.32972 WP_001114873.1.32995 WP_001114873.1.33018 WP_001114873.1.33341 WP_001114873.1.33475 WP_001114873.1.33512 WP_001114873.1.3354 WP_001114873.1.33595 WP_001114873.1.33638 WP_001114873.1.33680 WP_001114873.1.33823 WP_001114873.1.33914 WP_001114873.1.34094 WP_001114873.1.3411 WP_001114873.1.34122 WP_001114873.1.34206 WP_001114873.1.3444 WP_001114873.1.34682 WP_001114873.1.34794 WP_001114873.1.34855 WP_001114873.1.35316 WP_001114873.1.35365 WP_001114873.1.3539 WP_001114873.1.35464 WP_001114873.1.35465 WP_001114873.1.35468 WP_001114873.1.35604 WP_001114873.1.35653 WP_001114873.1.35704 WP_001114873.1.35927 WP_001114873.1.35934 WP_001114873.1.35942 WP_001114873.1.36042 WP_001114873.1.36070 WP_001114873.1.36071 WP_001114873.1.36094 WP_001114873.1.36166 WP_001114873.1.36177 WP_001114873.1.36426 WP_001114873.1.36500 WP_001114873.1.36610 WP_001114873.1.36628 WP_001114873.1.36707 WP_001114873.1.36739 WP_001114873.1.36806 WP_001114873.1.36812 WP_001114873.1.36826 WP_001114873.1.36975 WP_001114873.1.37046 WP_001114873.1.37099 WP_001114873.1.37206 WP_001114873.1.37252 WP_001114873.1.37334 WP_001114873.1.37476 WP_001114873.1.37510 WP_001114873.1.37554 WP_001114873.1.37634 WP_001114873.1.377 WP_001114873.1.3772 WP_001114873.1.3788 WP_001114873.1.37917 WP_001114873.1.37926 WP_001114873.1.37995 WP_001114873.1.38033 WP_001114873.1.38081 WP_001114873.1.38103 WP_001114873.1.38120 WP_001114873.1.38155 WP_001114873.1.3822 WP_001114873.1.38257 WP_001114873.1.38314 WP_001114873.1.38357 WP_001114873.1.38626 WP_001114873.1.38629 WP_001114873.1.38694 WP_001114873.1.38722 WP_001114873.1.3873 WP_001114873.1.38811 WP_001114873.1.38896 WP_001114873.1.38911 WP_001114873.1.38935 WP_001114873.1.39005 WP_001114873.1.39037 WP_001114873.1.3904 WP_001114873.1.39042 WP_001114873.1.39103 WP_001114873.1.39123 WP_001114873.1.39150 WP_001114873.1.39167 WP_001114873.1.39305 WP_001114873.1.39594 WP_001114873.1.39610 WP_001114873.1.39636 WP_001114873.1.39690 WP_001114873.1.3970 WP_001114873.1.39780 WP_001114873.1.39822 WP_001114873.1.39998 WP_001114873.1.40088 WP_001114873.1.40147 WP_001114873.1.40206 WP_001114873.1.40249 WP_001114873.1.40315 WP_001114873.1.40382 WP_001114873.1.40391 WP_001114873.1.40403 WP_001114873.1.4049 WP_001114873.1.40502 WP_001114873.1.40596 WP_001114873.1.40617 WP_001114873.1.40781 WP_001114873.1.40813 WP_001114873.1.4082 WP_001114873.1.40865 WP_001114873.1.41045 WP_001114873.1.41125 WP_001114873.1.41287 WP_001114873.1.41315 WP_001114873.1.41392 WP_001114873.1.41407 WP_001114873.1.4142 WP_001114873.1.41455 WP_001114873.1.41466 WP_001114873.1.41479 WP_001114873.1.41484 WP_001114873.1.41545 WP_001114873.1.41613 WP_001114873.1.41712 WP_001114873.1.4172 WP_001114873.1.41740 WP_001114873.1.41752 WP_001114873.1.41784 WP_001114873.1.41988 WP_001114873.1.42038 WP_001114873.1.42060 WP_001114873.1.42073 WP_001114873.1.42138 WP_001114873.1.4214 WP_001114873.1.42203 WP_001114873.1.42226 WP_001114873.1.42233 WP_001114873.1.4224 WP_001114873.1.42252 WP_001114873.1.42367 WP_001114873.1.42387 WP_001114873.1.42442 WP_001114873.1.42480 WP_001114873.1.42522 WP_001114873.1.42632 WP_001114873.1.42661 WP_001114873.1.42669 WP_001114873.1.42748 WP_001114873.1.42756 WP_001114873.1.42832 WP_001114873.1.42891 WP_001114873.1.42937 WP_001114873.1.42950 WP_001114873.1.43132 WP_001114873.1.43137 WP_001114873.1.43166 WP_001114873.1.43174 WP_001114873.1.43177 WP_001114873.1.43239 WP_001114873.1.43316 WP_001114873.1.43363 WP_001114873.1.4342 WP_001114873.1.43474 WP_001114873.1.43642 WP_001114873.1.43769 WP_001114873.1.43858 WP_001114873.1.44018 WP_001114873.1.44029 WP_001114873.1.44040 WP_001114873.1.44075 WP_001114873.1.44077 WP_001114873.1.44273 WP_001114873.1.44285 WP_001114873.1.44292 WP_001114873.1.44445 WP_001114873.1.4449 WP_001114873.1.44524 WP_001114873.1.44570 WP_001114873.1.44587 WP_001114873.1.44608 WP_001114873.1.44661 WP_001114873.1.44756 WP_001114873.1.44961 WP_001114873.1.45301 WP_001114873.1.45359 WP_001114873.1.45444 WP_001114873.1.45600 WP_001114873.1.45718 WP_001114873.1.45840 WP_001114873.1.45865 WP_001114873.1.45868 WP_001114873.1.45930 WP_001114873.1.45945 WP_001114873.1.45960 WP_001114873.1.45968 WP_001114873.1.4600 WP_001114873.1.46027 WP_001114873.1.46048 WP_001114873.1.46049 WP_001114873.1.46070 WP_001114873.1.46081 WP_001114873.1.46105 WP_001114873.1.46239 WP_001114873.1.46257 WP_001114873.1.46433 WP_001114873.1.4646 WP_001114873.1.46477 WP_001114873.1.46555 WP_001114873.1.46573 WP_001114873.1.46602 WP_001114873.1.46614 WP_001114873.1.46616 WP_001114873.1.46643 WP_001114873.1.46668 WP_001114873.1.46743 WP_001114873.1.46821 WP_001114873.1.46882 WP_001114873.1.46912 WP_001114873.1.46990 WP_001114873.1.47029 WP_001114873.1.47034 WP_001114873.1.47050 WP_001114873.1.47069 WP_001114873.1.47156 WP_001114873.1.47246 WP_001114873.1.47280 WP_001114873.1.47307 WP_001114873.1.47319 WP_001114873.1.47332 WP_001114873.1.47370 WP_001114873.1.47386 WP_001114873.1.47398 WP_001114873.1.47473 WP_001114873.1.47477 WP_001114873.1.47529 WP_001114873.1.47662 WP_001114873.1.47764 WP_001114873.1.47820 WP_001114873.1.47976 WP_001114873.1.48077 WP_001114873.1.48144 WP_001114873.1.48188 WP_001114873.1.48291 WP_001114873.1.48355 WP_001114873.1.48385 WP_001114873.1.48433 WP_001114873.1.48480 WP_001114873.1.4857 WP_001114873.1.48571 WP_001114873.1.48615 WP_001114873.1.48678 WP_001114873.1.48801 WP_001114873.1.48847 WP_001114873.1.48901 WP_001114873.1.48921 WP_001114873.1.48928 WP_001114873.1.48954 WP_001114873.1.49107 WP_001114873.1.49124 WP_001114873.1.49147 WP_001114873.1.49190 WP_001114873.1.49229 WP_001114873.1.49243 WP_001114873.1.49336 WP_001114873.1.49459 WP_001114873.1.49481 WP_001114873.1.4949 WP_001114873.1.49546 WP_001114873.1.49599 WP_001114873.1.49712 WP_001114873.1.49722 WP_001114873.1.49740 WP_001114873.1.49747 WP_001114873.1.49774 WP_001114873.1.49856 WP_001114873.1.49879 WP_001114873.1.49950 WP_001114873.1.49954 WP_001114873.1.49987 WP_001114873.1.50036 WP_001114873.1.50182 WP_001114873.1.50207 WP_001114873.1.50258 WP_001114873.1.50353 WP_001114873.1.50418 WP_001114873.1.50586 WP_001114873.1.5064 WP_001114873.1.50939 WP_001114873.1.51058 WP_001114873.1.51109 WP_001114873.1.51175 WP_001114873.1.51248 WP_001114873.1.51260 WP_001114873.1.51278 WP_001114873.1.51299 WP_001114873.1.51323 WP_001114873.1.51380 WP_001114873.1.51405 WP_001114873.1.51427 WP_001114873.1.51462 WP_001114873.1.51490 WP_001114873.1.51525 WP_001114873.1.51537 WP_001114873.1.51548 WP_001114873.1.5157 WP_001114873.1.51587 WP_001114873.1.51707 WP_001114873.1.51718 WP_001114873.1.5172 WP_001114873.1.51837 WP_001114873.1.51839 WP_001114873.1.51899 WP_001114873.1.51985 WP_001114873.1.51988 WP_001114873.1.51999 WP_001114873.1.52171 WP_001114873.1.5227 WP_001114873.1.52272 WP_001114873.1.52419 WP_001114873.1.52421 WP_001114873.1.52612 WP_001114873.1.52662 WP_001114873.1.52691 WP_001114873.1.52710 WP_001114873.1.52735 WP_001114873.1.52777 WP_001114873.1.52801 WP_001114873.1.52846 WP_001114873.1.52908 WP_001114873.1.52913 WP_001114873.1.52995 WP_001114873.1.5310 WP_001114873.1.53155 WP_001114873.1.532 WP_001114873.1.53238 WP_001114873.1.53242 WP_001114873.1.53251 WP_001114873.1.53262 WP_001114873.1.53356 WP_001114873.1.53401 WP_001114873.1.5342 WP_001114873.1.53537 WP_001114873.1.53590 WP_001114873.1.53594 WP_001114873.1.5362 WP_001114873.1.53642 WP_001114873.1.53809 WP_001114873.1.53841 WP_001114873.1.53866 WP_001114873.1.53978 WP_001114873.1.54023 WP_001114873.1.54072 WP_001114873.1.54091 WP_001114873.1.54169 WP_001114873.1.54185 WP_001114873.1.54202 WP_001114873.1.54263 WP_001114873.1.54307 WP_001114873.1.54329 WP_001114873.1.54463 WP_001114873.1.54476 WP_001114873.1.54546 WP_001114873.1.5460 WP_001114873.1.54638 WP_001114873.1.54688 WP_001114873.1.54695 WP_001114873.1.54708 WP_001114873.1.54725 WP_001114873.1.54729 WP_001114873.1.54798 WP_001114873.1.54817 WP_001114873.1.54918 WP_001114873.1.54991 WP_001114873.1.55005 WP_001114873.1.55112 WP_001114873.1.55115 WP_001114873.1.55134 WP_001114873.1.5520 WP_001114873.1.55222 WP_001114873.1.55291 WP_001114873.1.55338 WP_001114873.1.55357 WP_001114873.1.55381 WP_001114873.1.55417 WP_001114873.1.55425 WP_001114873.1.55552 WP_001114873.1.5561 WP_001114873.1.5570 WP_001114873.1.55709 WP_001114873.1.55720 WP_001114873.1.55730 WP_001114873.1.55757 WP_001114873.1.55787 WP_001114873.1.55844 WP_001114873.1.55988 WP_001114873.1.56149 WP_001114873.1.56177 WP_001114873.1.56193 WP_001114873.1.56197 WP_001114873.1.56216 WP_001114873.1.56231 WP_001114873.1.56285 WP_001114873.1.56302 WP_001114873.1.56371 WP_001114873.1.56390 WP_001114873.1.56399 WP_001114873.1.56439 WP_001114873.1.5646 WP_001114873.1.56513 WP_001114873.1.56543 WP_001114873.1.56586 WP_001114873.1.56665 WP_001114873.1.56680 WP_001114873.1.56689 WP_001114873.1.5670 WP_001114873.1.56704 WP_001114873.1.56721 WP_001114873.1.56742 WP_001114873.1.56799 WP_001114873.1.56835 WP_001114873.1.5685 WP_001114873.1.57100 WP_001114873.1.57185 WP_001114873.1.57222 WP_001114873.1.5748 WP_001114873.1.57538 WP_001114873.1.5755 WP_001114873.1.57638 WP_001114873.1.57659 WP_001114873.1.57669 WP_001114873.1.57738 WP_001114873.1.57812 WP_001114873.1.57920 WP_001114873.1.58022 WP_001114873.1.58045 WP_001114873.1.58060 WP_001114873.1.58146 WP_001114873.1.58163 WP_001114873.1.58172 WP_001114873.1.58206 WP_001114873.1.58267 WP_001114873.1.58289 WP_001114873.1.58371 WP_001114873.1.58384 WP_001114873.1.58445 WP_001114873.1.58507 WP_001114873.1.58514 WP_001114873.1.58528 WP_001114873.1.58547 WP_001114873.1.58572 WP_001114873.1.58622 WP_001114873.1.58837 WP_001114873.1.58977 WP_001114873.1.58983 WP_001114873.1.59035 WP_001114873.1.5906 WP_001114873.1.59119 WP_001114873.1.59190 WP_001114873.1.59280 WP_001114873.1.59302 WP_001114873.1.59409 WP_001114873.1.59621 WP_001114873.1.59638 WP_001114873.1.59737 WP_001114873.1.59782 WP_001114873.1.59791 WP_001114873.1.59877 WP_001114873.1.59912 WP_001114873.1.59932 WP_001114873.1.60070 WP_001114873.1.6022 WP_001114873.1.60325 WP_001114873.1.60387 WP_001114873.1.60457 WP_001114873.1.6059 WP_001114873.1.60606 WP_001114873.1.6064 WP_001114873.1.60698 WP_001114873.1.60732 WP_001114873.1.60832 WP_001114873.1.60835 WP_001114873.1.61005 WP_001114873.1.61008 WP_001114873.1.61035 WP_001114873.1.61058 WP_001114873.1.6110 WP_001114873.1.61112 WP_001114873.1.61225 WP_001114873.1.61292 WP_001114873.1.61398 WP_001114873.1.61636 WP_001114873.1.61758 WP_001114873.1.61948 WP_001114873.1.61955 WP_001114873.1.61957 WP_001114873.1.62290 WP_001114873.1.62460 WP_001114873.1.62487 WP_001114873.1.62514 WP_001114873.1.62529 WP_001114873.1.62646 WP_001114873.1.62681 WP_001114873.1.62714 WP_001114873.1.62762 WP_001114873.1.62818 WP_001114873.1.62851 WP_001114873.1.62959 WP_001114873.1.62973 WP_001114873.1.6299 WP_001114873.1.63177 WP_001114873.1.63246 WP_001114873.1.63370 WP_001114873.1.63437 WP_001114873.1.63466 WP_001114873.1.63467 WP_001114873.1.63470 WP_001114873.1.63484 WP_001114873.1.63491 WP_001114873.1.63536 WP_001114873.1.63556 WP_001114873.1.63576 WP_001114873.1.63666 WP_001114873.1.64008 WP_001114873.1.64014 WP_001114873.1.64050 WP_001114873.1.64074 WP_001114873.1.64150 WP_001114873.1.64175 WP_001114873.1.64286 WP_001114873.1.64356 WP_001114873.1.64380 WP_001114873.1.64391 WP_001114873.1.64438 WP_001114873.1.64458 WP_001114873.1.64657 WP_001114873.1.64749 WP_001114873.1.64970 WP_001114873.1.65040 WP_001114873.1.65097 WP_001114873.1.65151 WP_001114873.1.65155 WP_001114873.1.65179 WP_001114873.1.65305 WP_001114873.1.654 WP_001114873.1.65581 WP_001114873.1.65708 WP_001114873.1.65762 WP_001114873.1.65962 WP_001114873.1.6599 WP_001114873.1.6604 WP_001114873.1.6609 WP_001114873.1.66094 WP_001114873.1.66121 WP_001114873.1.66181 WP_001114873.1.66187 WP_001114873.1.66280 WP_001114873.1.66288 WP_001114873.1.66412 WP_001114873.1.66579 WP_001114873.1.66758 WP_001114873.1.6676 WP_001114873.1.66783 WP_001114873.1.67018 WP_001114873.1.67026 WP_001114873.1.67102 WP_001114873.1.67120 WP_001114873.1.67194 WP_001114873.1.67200 WP_001114873.1.67209 WP_001114873.1.6723 WP_001114873.1.67293 WP_001114873.1.67383 WP_001114873.1.67663 WP_001114873.1.67732 WP_001114873.1.678 WP_001114873.1.67841 WP_001114873.1.68011 WP_001114873.1.68039 WP_001114873.1.68175 WP_001114873.1.682 WP_001114873.1.68241 WP_001114873.1.68255 WP_001114873.1.68278 WP_001114873.1.68300 WP_001114873.1.68347 WP_001114873.1.6860 WP_001114873.1.68609 WP_001114873.1.68673 WP_001114873.1.68678 WP_001114873.1.68695 WP_001114873.1.69127 WP_001114873.1.694 WP_001114873.1.6945 WP_001114873.1.69551 WP_001114873.1.69649 WP_001114873.1.69689 WP_001114873.1.69887 WP_001114873.1.70213 WP_001114873.1.70477 WP_001114873.1.7052 WP_001114873.1.70582 WP_001114873.1.70628 WP_001114873.1.70694 WP_001114873.1.70745 WP_001114873.1.70748 WP_001114873.1.70801 WP_001114873.1.70952 WP_001114873.1.70967 WP_001114873.1.71113 WP_001114873.1.71134 WP_001114873.1.71162 WP_001114873.1.71221 WP_001114873.1.71272 WP_001114873.1.71275 WP_001114873.1.71327 WP_001114873.1.71403 WP_001114873.1.71537 WP_001114873.1.71540 WP_001114873.1.71632 WP_001114873.1.71680 WP_001114873.1.71757 WP_001114873.1.71767 WP_001114873.1.71856 WP_001114873.1.71874 WP_001114873.1.7192 WP_001114873.1.71987 WP_001114873.1.72033 WP_001114873.1.72053 WP_001114873.1.72090 WP_001114873.1.72125 WP_001114873.1.72141 WP_001114873.1.72153 WP_001114873.1.72240 WP_001114873.1.72261 WP_001114873.1.72270 WP_001114873.1.72279 WP_001114873.1.72493 WP_001114873.1.72521 WP_001114873.1.72535 WP_001114873.1.72608 WP_001114873.1.72643 WP_001114873.1.72695 WP_001114873.1.72725 WP_001114873.1.72729 WP_001114873.1.72758 WP_001114873.1.7277 WP_001114873.1.72858 WP_001114873.1.73010 WP_001114873.1.73032 WP_001114873.1.73072 WP_001114873.1.73075 WP_001114873.1.73197 WP_001114873.1.73239 WP_001114873.1.73249 WP_001114873.1.73251 WP_001114873.1.73326 WP_001114873.1.73349 WP_001114873.1.73428 WP_001114873.1.73468 WP_001114873.1.7349 WP_001114873.1.73663 WP_001114873.1.73700 WP_001114873.1.73709 WP_001114873.1.73797 WP_001114873.1.73807 WP_001114873.1.73827 WP_001114873.1.73843 WP_001114873.1.73882 WP_001114873.1.73908 WP_001114873.1.73995 WP_001114873.1.7413 WP_001114873.1.7425 WP_001114873.1.74423 WP_001114873.1.74431 WP_001114873.1.74478 WP_001114873.1.74513 WP_001114873.1.74624 WP_001114873.1.74687 WP_001114873.1.74735 WP_001114873.1.7478 WP_001114873.1.74811 WP_001114873.1.74885 WP_001114873.1.75021 WP_001114873.1.75112 WP_001114873.1.75254 WP_001114873.1.75360 WP_001114873.1.75435 WP_001114873.1.75529 WP_001114873.1.75588 WP_001114873.1.75629 WP_001114873.1.75653 WP_001114873.1.75676 WP_001114873.1.75687 WP_001114873.1.75696 WP_001114873.1.75973 WP_001114873.1.75999 WP_001114873.1.7603 WP_001114873.1.76036 WP_001114873.1.76087 WP_001114873.1.76103 WP_001114873.1.76129 WP_001114873.1.76384 WP_001114873.1.76387 WP_001114873.1.76390 WP_001114873.1.76542 WP_001114873.1.76595 WP_001114873.1.7661 WP_001114873.1.76619 WP_001114873.1.76656 WP_001114873.1.76840 WP_001114873.1.76948 WP_001114873.1.76965 WP_001114873.1.76966 WP_001114873.1.7699 WP_001114873.1.77015 WP_001114873.1.77022 WP_001114873.1.77070 WP_001114873.1.77109 WP_001114873.1.77147 WP_001114873.1.77162 WP_001114873.1.77291 WP_001114873.1.7731 WP_001114873.1.77341 WP_001114873.1.77462 WP_001114873.1.77477 WP_001114873.1.77495 WP_001114873.1.77551 WP_001114873.1.77581 WP_001114873.1.77608 WP_001114873.1.77626 WP_001114873.1.77767 WP_001114873.1.77826 WP_001114873.1.77833 WP_001114873.1.77929 WP_001114873.1.77949 WP_001114873.1.78007 WP_001114873.1.7808 WP_001114873.1.78102 WP_001114873.1.78445 WP_001114873.1.78586 WP_001114873.1.78610 WP_001114873.1.78615 WP_001114873.1.78683 WP_001114873.1.78698 WP_001114873.1.78757 WP_001114873.1.78775 WP_001114873.1.78791 WP_001114873.1.7883 WP_001114873.1.78843 WP_001114873.1.78854 WP_001114873.1.78888 WP_001114873.1.78891 WP_001114873.1.78919 WP_001114873.1.7898 WP_001114873.1.79067 WP_001114873.1.79306 WP_001114873.1.79343 WP_001114873.1.79346 WP_001114873.1.7937 WP_001114873.1.79391 WP_001114873.1.79525 WP_001114873.1.79526 WP_001114873.1.79606 WP_001114873.1.79713 WP_001114873.1.79800 WP_001114873.1.79824 WP_001114873.1.79930 WP_001114873.1.79932 WP_001114873.1.80043 WP_001114873.1.80060 WP_001114873.1.80071 WP_001114873.1.80106 WP_001114873.1.80141 WP_001114873.1.80176 WP_001114873.1.80310 WP_001114873.1.80426 WP_001114873.1.80444 WP_001114873.1.80484 WP_001114873.1.80626 WP_001114873.1.80709 WP_001114873.1.80753 WP_001114873.1.80754 WP_001114873.1.80894 WP_001114873.1.80945 WP_001114873.1.80946 WP_001114873.1.80983 WP_001114873.1.80985 WP_001114873.1.810 WP_001114873.1.81026 WP_001114873.1.81104 WP_001114873.1.81182 WP_001114873.1.81283 WP_001114873.1.81316 WP_001114873.1.81376 WP_001114873.1.81391 WP_001114873.1.81469 WP_001114873.1.81484 WP_001114873.1.81517 WP_001114873.1.81580 WP_001114873.1.81625 WP_001114873.1.81914 WP_001114873.1.81972 WP_001114873.1.82 WP_001114873.1.82059 WP_001114873.1.82062 WP_001114873.1.82137 WP_001114873.1.82239 WP_001114873.1.82240 WP_001114873.1.82242 WP_001114873.1.82326 WP_001114873.1.82378 WP_001114873.1.82485 WP_001114873.1.82499 WP_001114873.1.82572 WP_001114873.1.82831 WP_001114873.1.82902 WP_001114873.1.8345 WP_001114873.1.83481 WP_001114873.1.83564 WP_001114873.1.83684 WP_001114873.1.83762 WP_001114873.1.83947 WP_001114873.1.84140 WP_001114873.1.84172 WP_001114873.1.84313 WP_001114873.1.84436 WP_001114873.1.84473 WP_001114873.1.84656 WP_001114873.1.84668 WP_001114873.1.8470 WP_001114873.1.84841 WP_001114873.1.84850 WP_001114873.1.84877 WP_001114873.1.84881 WP_001114873.1.84893 WP_001114873.1.84941 WP_001114873.1.85098 WP_001114873.1.85112 WP_001114873.1.85129 WP_001114873.1.85155 WP_001114873.1.85335 WP_001114873.1.85342 WP_001114873.1.85435 WP_001114873.1.85500 WP_001114873.1.85525 WP_001114873.1.85762 WP_001114873.1.85944 WP_001114873.1.86016 WP_001114873.1.86035 WP_001114873.1.86115 WP_001114873.1.86181 WP_001114873.1.86210 WP_001114873.1.86263 WP_001114873.1.86307 WP_001114873.1.86364 WP_001114873.1.86376 WP_001114873.1.86393 WP_001114873.1.86411 WP_001114873.1.86451 WP_001114873.1.86454 WP_001114873.1.86492 WP_001114873.1.8652 WP_001114873.1.86583 WP_001114873.1.86598 WP_001114873.1.86674 WP_001114873.1.86833 WP_001114873.1.8687 WP_001114873.1.86956 WP_001114873.1.87075 WP_001114873.1.87109 WP_001114873.1.8711 WP_001114873.1.87310 WP_001114873.1.87358 WP_001114873.1.87410 WP_001114873.1.87465 WP_001114873.1.87607 WP_001114873.1.87639 WP_001114873.1.87694 WP_001114873.1.87728 WP_001114873.1.87973 WP_001114873.1.88020 WP_001114873.1.88088 WP_001114873.1.88155 WP_001114873.1.88238 WP_001114873.1.88252 WP_001114873.1.88379 WP_001114873.1.88384 WP_001114873.1.88427 WP_001114873.1.88462 WP_001114873.1.88535 WP_001114873.1.88539 WP_001114873.1.88598 WP_001114873.1.88631 WP_001114873.1.88646 WP_001114873.1.88709 WP_001114873.1.88757 WP_001114873.1.88759 WP_001114873.1.89050 WP_001114873.1.8906 WP_001114873.1.89067 WP_001114873.1.89183 WP_001114873.1.89197 WP_001114873.1.894 WP_001114873.1.89432 WP_001114873.1.8945 WP_001114873.1.89474 WP_001114873.1.89479 WP_001114873.1.89601 WP_001114873.1.89646 WP_001114873.1.89768 WP_001114873.1.89818 WP_001114873.1.89839 WP_001114873.1.89895 WP_001114873.1.89915 WP_001114873.1.89920 WP_001114873.1.89977 WP_001114873.1.90063 WP_001114873.1.9009 WP_001114873.1.9010 WP_001114873.1.90156 WP_001114873.1.90266 WP_001114873.1.90270 WP_001114873.1.90405 WP_001114873.1.90435 WP_001114873.1.90441 WP_001114873.1.90467 WP_001114873.1.90547 WP_001114873.1.9059 WP_001114873.1.90591 WP_001114873.1.9061 WP_001114873.1.90626 WP_001114873.1.90706 WP_001114873.1.90822 WP_001114873.1.90834 WP_001114873.1.90856 WP_001114873.1.90864 WP_001114873.1.90873 WP_001114873.1.90979 WP_001114873.1.91094 WP_001114873.1.91113 WP_001114873.1.91266 WP_001114873.1.91268 WP_001114873.1.91290 WP_001114873.1.91485 WP_001114873.1.91565 WP_001114873.1.9160 WP_001114873.1.91643 WP_001114873.1.91644 WP_001114873.1.91672 WP_001114873.1.91685 WP_001114873.1.91782 WP_001114873.1.91787 WP_001114873.1.91951 WP_001114873.1.91959 WP_001114873.1.91971 WP_001114873.1.92014 WP_001114873.1.92048 WP_001114873.1.92058 WP_001114873.1.921 WP_001114873.1.92163 WP_001114873.1.92180 WP_001114873.1.92215 WP_001114873.1.92224 WP_001114873.1.92434 WP_001114873.1.92532 WP_001114873.1.9255 WP_001114873.1.92577 WP_001114873.1.9264 WP_001114873.1.9266 WP_001114873.1.92693 WP_001114873.1.92708 WP_001114873.1.92719 WP_001114873.1.92780 WP_001114873.1.93005 WP_001114873.1.93016 WP_001114873.1.93033 WP_001114873.1.93072 WP_001114873.1.93133 WP_001114873.1.93252 WP_001114873.1.93338 WP_001114873.1.93379 WP_001114873.1.93388 WP_001114873.1.93463 WP_001114873.1.93509 WP_001114873.1.93531 WP_001114873.1.93629 WP_001114873.1.93634 WP_001114873.1.93665 WP_001114873.1.93743 WP_001114873.1.93745 WP_001114873.1.93800 WP_001114873.1.93873 WP_001114873.1.93877 WP_001114873.1.93918 WP_001114873.1.93951 WP_001114873.1.93971 WP_001114873.1.94156 WP_001114873.1.94232 WP_001114873.1.94404 WP_001114873.1.94468 WP_001114873.1.94475 WP_001114873.1.94507 WP_001114873.1.94580 WP_001114873.1.94808 WP_001114873.1.94880 WP_001114873.1.94889 WP_001114873.1.95005 WP_001114873.1.95022 WP_001114873.1.95062 WP_001114873.1.9513 WP_001114873.1.95161 WP_001114873.1.95243 WP_001114873.1.95368 WP_001114873.1.95390 WP_001114873.1.95400 WP_001114873.1.95424 WP_001114873.1.95490 WP_001114873.1.95563 WP_001114873.1.95604 WP_001114873.1.95655 WP_001114873.1.95824 WP_001114873.1.95869 WP_001114873.1.96066 WP_001114873.1.96086 WP_001114873.1.96177 WP_001114873.1.96222 WP_001114873.1.96229 WP_001114873.1.96247 WP_001114873.1.96341 WP_001114873.1.96494 WP_001114873.1.965 WP_001114873.1.96541 WP_001114873.1.96562 WP_001114873.1.9661 WP_001114873.1.96817 WP_001114873.1.9690 WP_001114873.1.96924 WP_001114873.1.96944 WP_001114873.1.97059 WP_001114873.1.97200 WP_001114873.1.97344 WP_001114873.1.97356 WP_001114873.1.97361 WP_001114873.1.97434 WP_001114873.1.97459 WP_001114873.1.97544 WP_001114873.1.97560 WP_001114873.1.97822 WP_001114873.1.97932 WP_001114873.1.97937 WP_001114873.1.97962 WP_001114873.1.97996 WP_001114873.1.9816 WP_001114873.1.9817 WP_001114873.1.98232 WP_001114873.1.98239 WP_001114873.1.98357 WP_001114873.1.98400 WP_001114873.1.98451 WP_001114873.1.98549 WP_001114873.1.98578 WP_001114873.1.98614 WP_001114873.1.98683 WP_001114873.1.98702 WP_001114873.1.99029 WP_001114873.1.99046 WP_001114873.1.99168 WP_001114873.1.99295 WP_001114873.1.99302 WP_001114873.1.99304 WP_001114873.1.99334 WP_001114873.1.99345 WP_001114873.1.9940 WP_001114873.1.99471 WP_001114873.1.99475 WP_001114873.1.99486 WP_001114873.1.99511 WP_001114873.1.99592 WP_001114873.1.99632 WP_001114873.1.99827 WP_001114873.1.99869 YP_006777381.1.12065 gi|218696843|ref|YP_002404510.1| gi|251786408|ref|YP_003000712.1| gi|254163080|ref|YP_003046188.1| gi|386615925|ref|YP_006135591.1| gi|410480792|ref|YP_006768338.1| gi|209920613|ref|YP_002294697.1| gi|407471112|ref|YP_006782445.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]