SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|253772672|ref|YP_003035503.1| from Escherichia coli 'BL21-Gold(DE3)pLysS AG'

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|253772672|ref|YP_003035503.1|
Domain Number 1 Region: 6-249
Classification Level Classification E-value
Superfamily SIS domain 1.05e-65
Family mono-SIS domain 0.00000027
Further Details:      
 
Weak hits

Sequence:  gi|253772672|ref|YP_003035503.1|
Domain Number - Region: 235-280
Classification Level Classification E-value
Superfamily UBA-like 0.0643
Family UBA domain 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|253772672|ref|YP_003035503.1|
Sequence length 298
Comment N-acetylmuramic acid-6-phosphate etherase [Escherichia coli 'BL21-Gold(DE3)pLysS AG']
Sequence
MQLEKMITEGSNAASAEIDRVSTLEMCRIINDEDKTVPLAVERVLPDIAAAIDVIHAQVS
GGGRLIYLGAGTSGRLGILDASECPPTYGVKPGLVVGLIAGGEYAIQHAVEGAEDSREGG
INDLKNINLTAQDVVVGIAASGRTPYVIAGLEYARQLGCRTVGISCNPGSAVSTTAEFAI
TPIVGAEVVTGSSRMKAGTAQKLVLNMLSTGLMIKSGKVFGNLMVDVVATNEKLHVRQVN
IVKNATGCNAEQAEAALIACERNCKTAIVMVLKNLDAAEAKKRLDQHGGFIRQVLDKE
Download sequence
Identical sequences A0A0L1C8Q8 A0A140N6T1 A0A142H560
gi|251785762|ref|YP_003000066.1| WP_001175605.1.1058 WP_001175605.1.12060 WP_001175605.1.12675 WP_001175605.1.13002 WP_001175605.1.15600 WP_001175605.1.17360 WP_001175605.1.18588 WP_001175605.1.20170 WP_001175605.1.21017 WP_001175605.1.24316 WP_001175605.1.25312 WP_001175605.1.27611 WP_001175605.1.30783 WP_001175605.1.31506 WP_001175605.1.35704 WP_001175605.1.36739 WP_001175605.1.38155 WP_001175605.1.39167 WP_001175605.1.46573 WP_001175605.1.47356 WP_001175605.1.47764 WP_001175605.1.47848 WP_001175605.1.48847 WP_001175605.1.51380 WP_001175605.1.51548 WP_001175605.1.52421 WP_001175605.1.54476 WP_001175605.1.56197 WP_001175605.1.56285 WP_001175605.1.57185 WP_001175605.1.59912 WP_001175605.1.64519 WP_001175605.1.66280 WP_001175605.1.67200 WP_001175605.1.67999 WP_001175605.1.6945 WP_001175605.1.71632 WP_001175605.1.73743 WP_001175605.1.76948 WP_001175605.1.78791 WP_001175605.1.79306 WP_001175605.1.79936 WP_001175605.1.81576 WP_001175605.1.8345 WP_001175605.1.84877 WP_001175605.1.88711 WP_001175605.1.89977 WP_001175605.1.92005 WP_001175605.1.93971 WP_001175605.1.96279 gi|251785762|ref|YP_003000066.1| gi|254162411|ref|YP_003045519.1| 413997.ECB_02328 469008.ECBD_1253 gi|253772672|ref|YP_003035503.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]