SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|253774754|ref|YP_003037585.1| from Escherichia coli 'BL21-Gold(DE3)pLysS AG'

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|253774754|ref|YP_003037585.1|
Domain Number 1 Region: 1-189
Classification Level Classification E-value
Superfamily SIS domain 2.6e-52
Family mono-SIS domain 0.000000131
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|253774754|ref|YP_003037585.1|
Sequence length 192
Comment phosphoheptose isomerase [Escherichia coli 'BL21-Gold(DE3)pLysS AG']
Sequence
MYQDLIRNELNEAAETLANFLKDDANIHAIQRAAVLLADSFKAGGKVLSCGNGGSHCDAM
HFAEELTGRYRENRPGYPAIAISDVSHISCVGNDFGFNDIFSRYVEAVGREGDVLLGIST
SGNSANVIKAIAAAREKGMKVITLTGKDGGKMAGTADIEIRVPHFGYADRIQEIHIKVIH
ILIQLIEKEMVK
Download sequence
Identical sequences A0A023YRZ9 A0A024KU42 A0A025BW04 A0A026V342 A0A027U5D1 A0A028A4Q9 A0A028E763 A0A029IBW4 A0A029J2A0 A0A062YGH3 A0A064TXW0 A0A069XJ06 A0A070F9K7 A0A070SJ98 A0A070UIR2 A0A073G2J9 A0A073HTV8 A0A073UUG7 A0A074ITW7 A0A080GCA7 A0A0A8UE85 A0A0E0TUW1 A0A0E0Y3R3 A0A0E1LXV2 A0A0E1SUL5 A0A0E2L8Z9 A0A0E2TJ89 A0A0F6BZ89 A0A0F6F179 A0A0G3K515 A0A0H3EDD0 A0A0H3PIH1 A0A0I0KL72 A0A0K9TBL0 A0A0M9JBQ8 A0A0S3NGF5 A0A125X872 A0A127GGN5 A0A140NFF3 A0A142GZG7 A0A1C2SSS3 A0A1E3N6Y8 A0A1Q8MB22 A0A1Q8NKE7 A0A1S6T6V9 A0A1W2MD85 A0A1X3ISI5 A0A1X3JSF8 A0A1X3LN62 A0A1X3LTF0 A0A1Z3UUK0 A0A222QFF0 A0A2H1BIC3 A7ZHY1 A7ZWI6 B1IPP6 B1LHM8 B1XD84 B2U3R4 B3X0A3 B5Z0M1 B6HZW0 B7LHF3 B7M252 B7MC74 B7MQ59 B7N8A8 C3TP22 C4ZRV8 C8U1V4 C8UHA0 D3GS74 D3QWP4 D6HSF0 D6I5E3 D6J722 E0J7C1 E3PDK2 E3XHT7 E7SM77 E7T2C1 E7T9Q5 F3V2R0 F5MXL4 F5NQ79 G0FAZ0 H4I6S7 H4IMA8 H4J3P4 H4KCC6 H4L803 H4UEI7 I2RUA9 I2T0G6 I2UR32 I2W6I1 I2WSD3 I2XGX1 I4SXA3 I6C3Y0 I6D5Q8 I6DUE1 I6EVU4 I6G8C8 K0XAZ3 K4W9F5 K4XRF1 L2V947 L2XX49 L3PG11 L3QFZ1 L3QTT3 L4JHD9 M9GKL7 P63224 P63225 P63226 P63227 Q0TL93 Q325S4 Q3Z5B4 S0WGB1 S1E123 S1FJM3 S1H7Z6 S1I894 S1PKZ3 T5VP63 T6B109 T6IDG4 T9ALT8 T9DPX0 T9UFG9 V2QQI0 V2U3R2 V6FPM8 V8F6I5 W1F3U9 W1X674
gi|170079851|ref|YP_001729171.1| gi|15799927|ref|NP_285939.1| gi|260866382|ref|YP_003232784.1| gi|251783780|ref|YP_002998084.1| gi|251783780|ref|YP_002998084.1| gi|260853437|ref|YP_003227328.1| gi|222155067|ref|YP_002555206.1| gi|157157983|ref|YP_001461410.1| gi|254160338|ref|YP_003043446.1| gi|30061841|ref|NP_836012.1| gi|386637665|ref|YP_006104463.1| 000165243|e2i22A1|2007.6.1.7|A:21-212 000325769|e2i22B1|2007.6.1.7|B:21-212 000325770|e2i22C1|2007.6.1.7|C:21-212 000325771|e2i22D1|2007.6.1.7|D:21-212 000325772|e2i2wA1|2007.6.1.7|A:21-212 000325773|e2i2wB1|2007.6.1.7|B:21-212 000325774|e2i2wC1|2007.6.1.7|C:21-212 000325775|e2i2wD1|2007.6.1.7|D:21-212 cath|current|2i22A00/1-192 cath|current|2i22B00/1-192 cath|current|2i22C00/1-192 cath|current|2i22D00/1-192 cath|current|2i2wA00/1-192 cath|current|2i2wB00/1-192 cath|current|2i2wC00/1-192 cath|current|2i2wD00/1-192 d2i22a_ d2i22b_ d2i22c_ d2i22d_ d2i2wa_ d2i2wb_ d2i2wc_ d2i2wd_ gi|386703419|ref|YP_006167266.1| gi|383176855|ref|YP_005454860.1| gi|378714424|ref|YP_005279317.1| gi|387619984|ref|YP_006127611.1| gi|74310864|ref|YP_309283.1| gi|15829503|ref|NP_308276.1| gi|254791381|ref|YP_003076218.1| NP_308276.1.58667 NP_414757.1.90541 NP_706225.2.23235 WP_000284050.1.1000 WP_000284050.1.10001 WP_000284050.1.100014 WP_000284050.1.100044 WP_000284050.1.100052 WP_000284050.1.100063 WP_000284050.1.100066 WP_000284050.1.100073 WP_000284050.1.100085 WP_000284050.1.10010 WP_000284050.1.100111 WP_000284050.1.100116 WP_000284050.1.100135 WP_000284050.1.100138 WP_000284050.1.100151 WP_000284050.1.100185 WP_000284050.1.100194 WP_000284050.1.100220 WP_000284050.1.100227 WP_000284050.1.100251 WP_000284050.1.100252 WP_000284050.1.100281 WP_000284050.1.100283 WP_000284050.1.100299 WP_000284050.1.100302 WP_000284050.1.100304 WP_000284050.1.100306 WP_000284050.1.100315 WP_000284050.1.10034 WP_000284050.1.100346 WP_000284050.1.100389 WP_000284050.1.100425 WP_000284050.1.100441 WP_000284050.1.100444 WP_000284050.1.100447 WP_000284050.1.100448 WP_000284050.1.100451 WP_000284050.1.100474 WP_000284050.1.10048 WP_000284050.1.100496 WP_000284050.1.100499 WP_000284050.1.100508 WP_000284050.1.10051 WP_000284050.1.100543 WP_000284050.1.100554 WP_000284050.1.100571 WP_000284050.1.100573 WP_000284050.1.100614 WP_000284050.1.100667 WP_000284050.1.10067 WP_000284050.1.10068 WP_000284050.1.100685 WP_000284050.1.100688 WP_000284050.1.100689 WP_000284050.1.100718 WP_000284050.1.100725 WP_000284050.1.100735 WP_000284050.1.100738 WP_000284050.1.100752 WP_000284050.1.100753 WP_000284050.1.100758 WP_000284050.1.100778 WP_000284050.1.100796 WP_000284050.1.10080 WP_000284050.1.100803 WP_000284050.1.100824 WP_000284050.1.100836 WP_000284050.1.100851 WP_000284050.1.100852 WP_000284050.1.10086 WP_000284050.1.100867 WP_000284050.1.100868 WP_000284050.1.100898 WP_000284050.1.100916 WP_000284050.1.100925 WP_000284050.1.100928 WP_000284050.1.100933 WP_000284050.1.10094 WP_000284050.1.100950 WP_000284050.1.100959 WP_000284050.1.100990 WP_000284050.1.10100 WP_000284050.1.101033 WP_000284050.1.101052 WP_000284050.1.101087 WP_000284050.1.101096 WP_000284050.1.1011 WP_000284050.1.101102 WP_000284050.1.101105 WP_000284050.1.101110 WP_000284050.1.101121 WP_000284050.1.101148 WP_000284050.1.101152 WP_000284050.1.101157 WP_000284050.1.101158 WP_000284050.1.101166 WP_000284050.1.101175 WP_000284050.1.101186 WP_000284050.1.101206 WP_000284050.1.101214 WP_000284050.1.101216 WP_000284050.1.101255 WP_000284050.1.101257 WP_000284050.1.10126 WP_000284050.1.101282 WP_000284050.1.101289 WP_000284050.1.101313 WP_000284050.1.101359 WP_000284050.1.10138 WP_000284050.1.101387 WP_000284050.1.101399 WP_000284050.1.101418 WP_000284050.1.101423 WP_000284050.1.101429 WP_000284050.1.101430 WP_000284050.1.101436 WP_000284050.1.101468 WP_000284050.1.101486 WP_000284050.1.101518 WP_000284050.1.101522 WP_000284050.1.10154 WP_000284050.1.101545 WP_000284050.1.101583 WP_000284050.1.101586 WP_000284050.1.101594 WP_000284050.1.101628 WP_000284050.1.101630 WP_000284050.1.101651 WP_000284050.1.101653 WP_000284050.1.101654 WP_000284050.1.101667 WP_000284050.1.101668 WP_000284050.1.101686 WP_000284050.1.101693 WP_000284050.1.101700 WP_000284050.1.101727 WP_000284050.1.10173 WP_000284050.1.101737 WP_000284050.1.101747 WP_000284050.1.101769 WP_000284050.1.101777 WP_000284050.1.101786 WP_000284050.1.10181 WP_000284050.1.101822 WP_000284050.1.10184 WP_000284050.1.101840 WP_000284050.1.101845 WP_000284050.1.101855 WP_000284050.1.101865 WP_000284050.1.10187 WP_000284050.1.10188 WP_000284050.1.101887 WP_000284050.1.101889 WP_000284050.1.10190 WP_000284050.1.101900 WP_000284050.1.101908 WP_000284050.1.101913 WP_000284050.1.101926 WP_000284050.1.101932 WP_000284050.1.101937 WP_000284050.1.101940 WP_000284050.1.101942 WP_000284050.1.101947 WP_000284050.1.101948 WP_000284050.1.101952 WP_000284050.1.101964 WP_000284050.1.101969 WP_000284050.1.101977 WP_000284050.1.101984 WP_000284050.1.101987 WP_000284050.1.102021 WP_000284050.1.102036 WP_000284050.1.10206 WP_000284050.1.102069 WP_000284050.1.102076 WP_000284050.1.102093 WP_000284050.1.102094 WP_000284050.1.102104 WP_000284050.1.102106 WP_000284050.1.102122 WP_000284050.1.102139 WP_000284050.1.102144 WP_000284050.1.10222 WP_000284050.1.10226 WP_000284050.1.10233 WP_000284050.1.10235 WP_000284050.1.10252 WP_000284050.1.10273 WP_000284050.1.10304 WP_000284050.1.10326 WP_000284050.1.10329 WP_000284050.1.10335 WP_000284050.1.10348 WP_000284050.1.10352 WP_000284050.1.10361 WP_000284050.1.10381 WP_000284050.1.1040 WP_000284050.1.10400 WP_000284050.1.10417 WP_000284050.1.10461 WP_000284050.1.10476 WP_000284050.1.10491 WP_000284050.1.10492 WP_000284050.1.10496 WP_000284050.1.10508 WP_000284050.1.10524 WP_000284050.1.10525 WP_000284050.1.10538 WP_000284050.1.10569 WP_000284050.1.10573 WP_000284050.1.10576 WP_000284050.1.10579 WP_000284050.1.1058 WP_000284050.1.10605 WP_000284050.1.10607 WP_000284050.1.10628 WP_000284050.1.10651 WP_000284050.1.10673 WP_000284050.1.10697 WP_000284050.1.10705 WP_000284050.1.1071 WP_000284050.1.10715 WP_000284050.1.10729 WP_000284050.1.1073 WP_000284050.1.1074 WP_000284050.1.10744 WP_000284050.1.10748 WP_000284050.1.10761 WP_000284050.1.10763 WP_000284050.1.10771 WP_000284050.1.10786 WP_000284050.1.10787 WP_000284050.1.10798 WP_000284050.1.10814 WP_000284050.1.10824 WP_000284050.1.10833 WP_000284050.1.10842 WP_000284050.1.10849 WP_000284050.1.10862 WP_000284050.1.10869 WP_000284050.1.10922 WP_000284050.1.10940 WP_000284050.1.10970 WP_000284050.1.10988 WP_000284050.1.10989 WP_000284050.1.10994 WP_000284050.1.10995 WP_000284050.1.11006 WP_000284050.1.11032 WP_000284050.1.11047 WP_000284050.1.11052 WP_000284050.1.11057 WP_000284050.1.11068 WP_000284050.1.11071 WP_000284050.1.11091 WP_000284050.1.1111 WP_000284050.1.11113 WP_000284050.1.11118 WP_000284050.1.11121 WP_000284050.1.1113 WP_000284050.1.11133 WP_000284050.1.112 WP_000284050.1.11217 WP_000284050.1.1122 WP_000284050.1.11240 WP_000284050.1.11241 WP_000284050.1.11250 WP_000284050.1.11251 WP_000284050.1.11265 WP_000284050.1.11272 WP_000284050.1.11285 WP_000284050.1.11296 WP_000284050.1.11301 WP_000284050.1.11315 WP_000284050.1.11323 WP_000284050.1.11399 WP_000284050.1.11408 WP_000284050.1.1141 WP_000284050.1.11411 WP_000284050.1.11418 WP_000284050.1.11420 WP_000284050.1.11436 WP_000284050.1.11437 WP_000284050.1.11440 WP_000284050.1.11452 WP_000284050.1.11499 WP_000284050.1.11519 WP_000284050.1.11524 WP_000284050.1.11531 WP_000284050.1.11542 WP_000284050.1.11575 WP_000284050.1.11578 WP_000284050.1.11595 WP_000284050.1.11607 WP_000284050.1.11608 WP_000284050.1.11612 WP_000284050.1.11616 WP_000284050.1.11645 WP_000284050.1.11671 WP_000284050.1.11673 WP_000284050.1.1168 WP_000284050.1.11690 WP_000284050.1.11699 WP_000284050.1.11748 WP_000284050.1.11759 WP_000284050.1.1176 WP_000284050.1.11762 WP_000284050.1.11801 WP_000284050.1.11803 WP_000284050.1.11844 WP_000284050.1.1186 WP_000284050.1.11912 WP_000284050.1.11949 WP_000284050.1.11955 WP_000284050.1.11956 WP_000284050.1.1196 WP_000284050.1.11981 WP_000284050.1.11982 WP_000284050.1.11985 WP_000284050.1.12000 WP_000284050.1.12009 WP_000284050.1.12010 WP_000284050.1.12030 WP_000284050.1.12036 WP_000284050.1.12050 WP_000284050.1.12051 WP_000284050.1.12060 WP_000284050.1.12076 WP_000284050.1.12088 WP_000284050.1.12095 WP_000284050.1.12111 WP_000284050.1.12112 WP_000284050.1.12115 WP_000284050.1.1212 WP_000284050.1.12151 WP_000284050.1.12157 WP_000284050.1.12174 WP_000284050.1.1218 WP_000284050.1.12204 WP_000284050.1.12259 WP_000284050.1.12268 WP_000284050.1.12279 WP_000284050.1.12292 WP_000284050.1.12295 WP_000284050.1.12305 WP_000284050.1.12319 WP_000284050.1.12320 WP_000284050.1.12342 WP_000284050.1.12344 WP_000284050.1.12352 WP_000284050.1.12415 WP_000284050.1.1242 WP_000284050.1.12426 WP_000284050.1.12458 WP_000284050.1.12459 WP_000284050.1.12468 WP_000284050.1.12478 WP_000284050.1.12542 WP_000284050.1.12552 WP_000284050.1.12558 WP_000284050.1.12566 WP_000284050.1.12574 WP_000284050.1.12582 WP_000284050.1.12594 WP_000284050.1.12623 WP_000284050.1.12645 WP_000284050.1.12646 WP_000284050.1.12675 WP_000284050.1.12679 WP_000284050.1.12680 WP_000284050.1.12693 WP_000284050.1.12697 WP_000284050.1.127 WP_000284050.1.12709 WP_000284050.1.12717 WP_000284050.1.12743 WP_000284050.1.12749 WP_000284050.1.1275 WP_000284050.1.12756 WP_000284050.1.12761 WP_000284050.1.12762 WP_000284050.1.12763 WP_000284050.1.12766 WP_000284050.1.12775 WP_000284050.1.1278 WP_000284050.1.12781 WP_000284050.1.1280 WP_000284050.1.12826 WP_000284050.1.12830 WP_000284050.1.12831 WP_000284050.1.12876 WP_000284050.1.12893 WP_000284050.1.12911 WP_000284050.1.12914 WP_000284050.1.12915 WP_000284050.1.12917 WP_000284050.1.1295 WP_000284050.1.12956 WP_000284050.1.12965 WP_000284050.1.12976 WP_000284050.1.12979 WP_000284050.1.12987 WP_000284050.1.12991 WP_000284050.1.13002 WP_000284050.1.13015 WP_000284050.1.13031 WP_000284050.1.13060 WP_000284050.1.13074 WP_000284050.1.1308 WP_000284050.1.13117 WP_000284050.1.1312 WP_000284050.1.13136 WP_000284050.1.1314 WP_000284050.1.13144 WP_000284050.1.1315 WP_000284050.1.13157 WP_000284050.1.13162 WP_000284050.1.13176 WP_000284050.1.13181 WP_000284050.1.13205 WP_000284050.1.13217 WP_000284050.1.13222 WP_000284050.1.13223 WP_000284050.1.1323 WP_000284050.1.13239 WP_000284050.1.13252 WP_000284050.1.13258 WP_000284050.1.13271 WP_000284050.1.13272 WP_000284050.1.13278 WP_000284050.1.13281 WP_000284050.1.13295 WP_000284050.1.13301 WP_000284050.1.13332 WP_000284050.1.13333 WP_000284050.1.13346 WP_000284050.1.13348 WP_000284050.1.1335 WP_000284050.1.13383 WP_000284050.1.13393 WP_000284050.1.13411 WP_000284050.1.1343 WP_000284050.1.13430 WP_000284050.1.13437 WP_000284050.1.13442 WP_000284050.1.1345 WP_000284050.1.13451 WP_000284050.1.13469 WP_000284050.1.13473 WP_000284050.1.13481 WP_000284050.1.13492 WP_000284050.1.13495 WP_000284050.1.13525 WP_000284050.1.13566 WP_000284050.1.13585 WP_000284050.1.13589 WP_000284050.1.13601 WP_000284050.1.13608 WP_000284050.1.13618 WP_000284050.1.13624 WP_000284050.1.13626 WP_000284050.1.13644 WP_000284050.1.13656 WP_000284050.1.13662 WP_000284050.1.13664 WP_000284050.1.13672 WP_000284050.1.13740 WP_000284050.1.13778 WP_000284050.1.13791 WP_000284050.1.13798 WP_000284050.1.13824 WP_000284050.1.13867 WP_000284050.1.13877 WP_000284050.1.13881 WP_000284050.1.13891 WP_000284050.1.13924 WP_000284050.1.13934 WP_000284050.1.13936 WP_000284050.1.13939 WP_000284050.1.13944 WP_000284050.1.13949 WP_000284050.1.13974 WP_000284050.1.13981 WP_000284050.1.14023 WP_000284050.1.14030 WP_000284050.1.14042 WP_000284050.1.14058 WP_000284050.1.14062 WP_000284050.1.14070 WP_000284050.1.14094 WP_000284050.1.14110 WP_000284050.1.14127 WP_000284050.1.14129 WP_000284050.1.14144 WP_000284050.1.14154 WP_000284050.1.14164 WP_000284050.1.1419 WP_000284050.1.14199 WP_000284050.1.142 WP_000284050.1.14245 WP_000284050.1.14253 WP_000284050.1.14277 WP_000284050.1.14292 WP_000284050.1.14299 WP_000284050.1.14304 WP_000284050.1.14331 WP_000284050.1.14346 WP_000284050.1.14371 WP_000284050.1.1438 WP_000284050.1.1439 WP_000284050.1.14398 WP_000284050.1.14417 WP_000284050.1.14432 WP_000284050.1.14451 WP_000284050.1.14453 WP_000284050.1.14468 WP_000284050.1.14493 WP_000284050.1.14499 WP_000284050.1.14501 WP_000284050.1.14506 WP_000284050.1.14509 WP_000284050.1.14529 WP_000284050.1.14536 WP_000284050.1.14538 WP_000284050.1.14581 WP_000284050.1.14582 WP_000284050.1.14600 WP_000284050.1.14601 WP_000284050.1.14605 WP_000284050.1.14607 WP_000284050.1.1461 WP_000284050.1.14616 WP_000284050.1.14621 WP_000284050.1.14648 WP_000284050.1.14661 WP_000284050.1.14672 WP_000284050.1.14678 WP_000284050.1.14687 WP_000284050.1.14693 WP_000284050.1.1470 WP_000284050.1.14711 WP_000284050.1.14712 WP_000284050.1.14746 WP_000284050.1.14748 WP_000284050.1.14749 WP_000284050.1.14807 WP_000284050.1.14811 WP_000284050.1.14833 WP_000284050.1.1486 WP_000284050.1.14861 WP_000284050.1.14871 WP_000284050.1.14879 WP_000284050.1.14934 WP_000284050.1.14935 WP_000284050.1.14956 WP_000284050.1.14958 WP_000284050.1.14965 WP_000284050.1.14977 WP_000284050.1.14992 WP_000284050.1.14993 WP_000284050.1.15007 WP_000284050.1.15020 WP_000284050.1.15041 WP_000284050.1.1508 WP_000284050.1.15087 WP_000284050.1.15090 WP_000284050.1.1510 WP_000284050.1.15117 WP_000284050.1.1512 WP_000284050.1.15121 WP_000284050.1.15138 WP_000284050.1.15148 WP_000284050.1.15177 WP_000284050.1.15191 WP_000284050.1.15193 WP_000284050.1.15207 WP_000284050.1.15221 WP_000284050.1.1524 WP_000284050.1.15245 WP_000284050.1.15252 WP_000284050.1.15259 WP_000284050.1.15270 WP_000284050.1.15274 WP_000284050.1.15277 WP_000284050.1.15282 WP_000284050.1.15287 WP_000284050.1.15290 WP_000284050.1.153 WP_000284050.1.15300 WP_000284050.1.15304 WP_000284050.1.15332 WP_000284050.1.15335 WP_000284050.1.15347 WP_000284050.1.15356 WP_000284050.1.15377 WP_000284050.1.15416 WP_000284050.1.1543 WP_000284050.1.15444 WP_000284050.1.15453 WP_000284050.1.15464 WP_000284050.1.15469 WP_000284050.1.15496 WP_000284050.1.1550 WP_000284050.1.15503 WP_000284050.1.15521 WP_000284050.1.15527 WP_000284050.1.15528 WP_000284050.1.15538 WP_000284050.1.15565 WP_000284050.1.15576 WP_000284050.1.15583 WP_000284050.1.1559 WP_000284050.1.15593 WP_000284050.1.15600 WP_000284050.1.1561 WP_000284050.1.15620 WP_000284050.1.15624 WP_000284050.1.15626 WP_000284050.1.15645 WP_000284050.1.15654 WP_000284050.1.15702 WP_000284050.1.15707 WP_000284050.1.15731 WP_000284050.1.15747 WP_000284050.1.15752 WP_000284050.1.15762 WP_000284050.1.15767 WP_000284050.1.15768 WP_000284050.1.15771 WP_000284050.1.15782 WP_000284050.1.15791 WP_000284050.1.1580 WP_000284050.1.15809 WP_000284050.1.1582 WP_000284050.1.15855 WP_000284050.1.15857 WP_000284050.1.15863 WP_000284050.1.15869 WP_000284050.1.1588 WP_000284050.1.15894 WP_000284050.1.15906 WP_000284050.1.15916 WP_000284050.1.15945 WP_000284050.1.15949 WP_000284050.1.15951 WP_000284050.1.15983 WP_000284050.1.15984 WP_000284050.1.16014 WP_000284050.1.16015 WP_000284050.1.16034 WP_000284050.1.1604 WP_000284050.1.16042 WP_000284050.1.16067 WP_000284050.1.16075 WP_000284050.1.16086 WP_000284050.1.16087 WP_000284050.1.1609 WP_000284050.1.16102 WP_000284050.1.16111 WP_000284050.1.16117 WP_000284050.1.16131 WP_000284050.1.16133 WP_000284050.1.16154 WP_000284050.1.16171 WP_000284050.1.16175 WP_000284050.1.16179 WP_000284050.1.16183 WP_000284050.1.16188 WP_000284050.1.16194 WP_000284050.1.1621 WP_000284050.1.1622 WP_000284050.1.16222 WP_000284050.1.16270 WP_000284050.1.16272 WP_000284050.1.16294 WP_000284050.1.163 WP_000284050.1.16303 WP_000284050.1.16322 WP_000284050.1.1634 WP_000284050.1.16387 WP_000284050.1.16388 WP_000284050.1.16396 WP_000284050.1.1640 WP_000284050.1.16435 WP_000284050.1.16463 WP_000284050.1.16481 WP_000284050.1.16482 WP_000284050.1.16500 WP_000284050.1.16517 WP_000284050.1.16532 WP_000284050.1.16539 WP_000284050.1.16541 WP_000284050.1.1655 WP_000284050.1.16577 WP_000284050.1.16604 WP_000284050.1.16608 WP_000284050.1.16612 WP_000284050.1.16640 WP_000284050.1.16648 WP_000284050.1.16667 WP_000284050.1.16669 WP_000284050.1.16682 WP_000284050.1.16685 WP_000284050.1.16700 WP_000284050.1.16705 WP_000284050.1.16715 WP_000284050.1.16721 WP_000284050.1.1673 WP_000284050.1.16745 WP_000284050.1.16752 WP_000284050.1.16766 WP_000284050.1.16780 WP_000284050.1.16798 WP_000284050.1.16799 WP_000284050.1.16805 WP_000284050.1.16807 WP_000284050.1.16818 WP_000284050.1.16845 WP_000284050.1.16861 WP_000284050.1.16862 WP_000284050.1.16894 WP_000284050.1.16927 WP_000284050.1.16970 WP_000284050.1.16979 WP_000284050.1.16992 WP_000284050.1.17014 WP_000284050.1.17017 WP_000284050.1.17018 WP_000284050.1.17028 WP_000284050.1.17042 WP_000284050.1.17061 WP_000284050.1.17084 WP_000284050.1.17085 WP_000284050.1.17087 WP_000284050.1.17089 WP_000284050.1.1710 WP_000284050.1.17101 WP_000284050.1.17102 WP_000284050.1.17109 WP_000284050.1.17111 WP_000284050.1.17114 WP_000284050.1.17119 WP_000284050.1.17123 WP_000284050.1.17150 WP_000284050.1.17153 WP_000284050.1.17170 WP_000284050.1.17172 WP_000284050.1.17182 WP_000284050.1.17186 WP_000284050.1.17187 WP_000284050.1.17205 WP_000284050.1.17206 WP_000284050.1.17216 WP_000284050.1.17230 WP_000284050.1.17241 WP_000284050.1.17242 WP_000284050.1.1726 WP_000284050.1.17267 WP_000284050.1.17282 WP_000284050.1.17290 WP_000284050.1.17297 WP_000284050.1.17300 WP_000284050.1.17301 WP_000284050.1.1731 WP_000284050.1.17325 WP_000284050.1.17333 WP_000284050.1.17356 WP_000284050.1.17360 WP_000284050.1.17373 WP_000284050.1.17386 WP_000284050.1.17387 WP_000284050.1.17389 WP_000284050.1.17392 WP_000284050.1.17403 WP_000284050.1.17410 WP_000284050.1.17415 WP_000284050.1.17417 WP_000284050.1.17432 WP_000284050.1.17441 WP_000284050.1.17461 WP_000284050.1.17464 WP_000284050.1.17496 WP_000284050.1.17515 WP_000284050.1.17534 WP_000284050.1.1754 WP_000284050.1.1755 WP_000284050.1.17550 WP_000284050.1.17568 WP_000284050.1.17570 WP_000284050.1.17577 WP_000284050.1.17584 WP_000284050.1.17595 WP_000284050.1.17623 WP_000284050.1.1763 WP_000284050.1.17637 WP_000284050.1.1766 WP_000284050.1.17680 WP_000284050.1.1769 WP_000284050.1.17701 WP_000284050.1.17711 WP_000284050.1.1772 WP_000284050.1.17734 WP_000284050.1.17765 WP_000284050.1.17766 WP_000284050.1.17769 WP_000284050.1.1778 WP_000284050.1.17802 WP_000284050.1.17829 WP_000284050.1.17831 WP_000284050.1.17836 WP_000284050.1.17849 WP_000284050.1.17889 WP_000284050.1.17904 WP_000284050.1.17920 WP_000284050.1.17925 WP_000284050.1.17937 WP_000284050.1.17952 WP_000284050.1.17961 WP_000284050.1.17963 WP_000284050.1.17984 WP_000284050.1.18000 WP_000284050.1.18006 WP_000284050.1.1802 WP_000284050.1.18024 WP_000284050.1.18050 WP_000284050.1.18064 WP_000284050.1.18094 WP_000284050.1.18112 WP_000284050.1.18121 WP_000284050.1.18133 WP_000284050.1.18134 WP_000284050.1.18136 WP_000284050.1.18141 WP_000284050.1.18164 WP_000284050.1.18175 WP_000284050.1.1821 WP_000284050.1.18225 WP_000284050.1.18226 WP_000284050.1.18229 WP_000284050.1.18275 WP_000284050.1.18311 WP_000284050.1.18316 WP_000284050.1.18326 WP_000284050.1.18329 WP_000284050.1.18337 WP_000284050.1.18338 WP_000284050.1.1834 WP_000284050.1.18340 WP_000284050.1.18348 WP_000284050.1.18354 WP_000284050.1.18381 WP_000284050.1.18383 WP_000284050.1.18394 WP_000284050.1.18402 WP_000284050.1.18410 WP_000284050.1.18420 WP_000284050.1.18428 WP_000284050.1.18436 WP_000284050.1.18438 WP_000284050.1.1844 WP_000284050.1.18458 WP_000284050.1.18461 WP_000284050.1.18472 WP_000284050.1.18482 WP_000284050.1.18511 WP_000284050.1.18519 WP_000284050.1.18530 WP_000284050.1.18550 WP_000284050.1.18556 WP_000284050.1.18581 WP_000284050.1.18583 WP_000284050.1.18588 WP_000284050.1.1861 WP_000284050.1.18617 WP_000284050.1.1862 WP_000284050.1.18628 WP_000284050.1.18649 WP_000284050.1.18650 WP_000284050.1.18651 WP_000284050.1.18655 WP_000284050.1.1866 WP_000284050.1.18666 WP_000284050.1.1867 WP_000284050.1.18675 WP_000284050.1.18699 WP_000284050.1.18714 WP_000284050.1.18726 WP_000284050.1.1873 WP_000284050.1.18734 WP_000284050.1.18794 WP_000284050.1.188 WP_000284050.1.18802 WP_000284050.1.18806 WP_000284050.1.1881 WP_000284050.1.18828 WP_000284050.1.18837 WP_000284050.1.18843 WP_000284050.1.18858 WP_000284050.1.18861 WP_000284050.1.18874 WP_000284050.1.18876 WP_000284050.1.18899 WP_000284050.1.18908 WP_000284050.1.18929 WP_000284050.1.18934 WP_000284050.1.18936 WP_000284050.1.1896 WP_000284050.1.18962 WP_000284050.1.18966 WP_000284050.1.18983 WP_000284050.1.18995 WP_000284050.1.19024 WP_000284050.1.1903 WP_000284050.1.19036 WP_000284050.1.19039 WP_000284050.1.1906 WP_000284050.1.19075 WP_000284050.1.1909 WP_000284050.1.19090 WP_000284050.1.191 WP_000284050.1.19100 WP_000284050.1.19113 WP_000284050.1.19114 WP_000284050.1.19122 WP_000284050.1.19129 WP_000284050.1.19135 WP_000284050.1.19140 WP_000284050.1.19146 WP_000284050.1.19147 WP_000284050.1.19148 WP_000284050.1.1915 WP_000284050.1.19150 WP_000284050.1.19153 WP_000284050.1.19171 WP_000284050.1.19194 WP_000284050.1.19205 WP_000284050.1.19206 WP_000284050.1.19245 WP_000284050.1.1925 WP_000284050.1.19276 WP_000284050.1.19277 WP_000284050.1.19297 WP_000284050.1.193 WP_000284050.1.19312 WP_000284050.1.19313 WP_000284050.1.19314 WP_000284050.1.19315 WP_000284050.1.19332 WP_000284050.1.19338 WP_000284050.1.19347 WP_000284050.1.19350 WP_000284050.1.19379 WP_000284050.1.19389 WP_000284050.1.19397 WP_000284050.1.19419 WP_000284050.1.19424 WP_000284050.1.19441 WP_000284050.1.19448 WP_000284050.1.19453 WP_000284050.1.19465 WP_000284050.1.19478 WP_000284050.1.19487 WP_000284050.1.19492 WP_000284050.1.19494 WP_000284050.1.1952 WP_000284050.1.19534 WP_000284050.1.19544 WP_000284050.1.19545 WP_000284050.1.19547 WP_000284050.1.19557 WP_000284050.1.19581 WP_000284050.1.19583 WP_000284050.1.19593 WP_000284050.1.1960 WP_000284050.1.19602 WP_000284050.1.1963 WP_000284050.1.19644 WP_000284050.1.19649 WP_000284050.1.19651 WP_000284050.1.19654 WP_000284050.1.19655 WP_000284050.1.19661 WP_000284050.1.19684 WP_000284050.1.19691 WP_000284050.1.19758 WP_000284050.1.19760 WP_000284050.1.19761 WP_000284050.1.19778 WP_000284050.1.19795 WP_000284050.1.1982 WP_000284050.1.19830 WP_000284050.1.19838 WP_000284050.1.19840 WP_000284050.1.19845 WP_000284050.1.19847 WP_000284050.1.19861 WP_000284050.1.1987 WP_000284050.1.19873 WP_000284050.1.19878 WP_000284050.1.19889 WP_000284050.1.19940 WP_000284050.1.19945 WP_000284050.1.19957 WP_000284050.1.19972 WP_000284050.1.20025 WP_000284050.1.2005 WP_000284050.1.20096 WP_000284050.1.20114 WP_000284050.1.20115 WP_000284050.1.20129 WP_000284050.1.20133 WP_000284050.1.20136 WP_000284050.1.2015 WP_000284050.1.20157 WP_000284050.1.20159 WP_000284050.1.20164 WP_000284050.1.20166 WP_000284050.1.20170 WP_000284050.1.20178 WP_000284050.1.20183 WP_000284050.1.20192 WP_000284050.1.20215 WP_000284050.1.2022 WP_000284050.1.20224 WP_000284050.1.20230 WP_000284050.1.20238 WP_000284050.1.20251 WP_000284050.1.20264 WP_000284050.1.2027 WP_000284050.1.20277 WP_000284050.1.20289 WP_000284050.1.20290 WP_000284050.1.20308 WP_000284050.1.20318 WP_000284050.1.20325 WP_000284050.1.20331 WP_000284050.1.20334 WP_000284050.1.20370 WP_000284050.1.20388 WP_000284050.1.20442 WP_000284050.1.20445 WP_000284050.1.20449 WP_000284050.1.20452 WP_000284050.1.20480 WP_000284050.1.20483 WP_000284050.1.20484 WP_000284050.1.20493 WP_000284050.1.20515 WP_000284050.1.20519 WP_000284050.1.20536 WP_000284050.1.20546 WP_000284050.1.20549 WP_000284050.1.20565 WP_000284050.1.20575 WP_000284050.1.20594 WP_000284050.1.20596 WP_000284050.1.20609 WP_000284050.1.2063 WP_000284050.1.20630 WP_000284050.1.20636 WP_000284050.1.20638 WP_000284050.1.20640 WP_000284050.1.20662 WP_000284050.1.20668 WP_000284050.1.20691 WP_000284050.1.20709 WP_000284050.1.20724 WP_000284050.1.20730 WP_000284050.1.20737 WP_000284050.1.20741 WP_000284050.1.20745 WP_000284050.1.2075 WP_000284050.1.20761 WP_000284050.1.20765 WP_000284050.1.20784 WP_000284050.1.20785 WP_000284050.1.20803 WP_000284050.1.20813 WP_000284050.1.20818 WP_000284050.1.20824 WP_000284050.1.20831 WP_000284050.1.20841 WP_000284050.1.20848 WP_000284050.1.20863 WP_000284050.1.2089 WP_000284050.1.20893 WP_000284050.1.20907 WP_000284050.1.2092 WP_000284050.1.2093 WP_000284050.1.20933 WP_000284050.1.2094 WP_000284050.1.20941 WP_000284050.1.20943 WP_000284050.1.20950 WP_000284050.1.20958 WP_000284050.1.20962 WP_000284050.1.20982 WP_000284050.1.20989 WP_000284050.1.2100 WP_000284050.1.21017 WP_000284050.1.21020 WP_000284050.1.21022 WP_000284050.1.21024 WP_000284050.1.21029 WP_000284050.1.21033 WP_000284050.1.21041 WP_000284050.1.21057 WP_000284050.1.21059 WP_000284050.1.21104 WP_000284050.1.21122 WP_000284050.1.21129 WP_000284050.1.2113 WP_000284050.1.21131 WP_000284050.1.21137 WP_000284050.1.21152 WP_000284050.1.21171 WP_000284050.1.21197 WP_000284050.1.21236 WP_000284050.1.21248 WP_000284050.1.21251 WP_000284050.1.21255 WP_000284050.1.21266 WP_000284050.1.21277 WP_000284050.1.21305 WP_000284050.1.21320 WP_000284050.1.21336 WP_000284050.1.21378 WP_000284050.1.21441 WP_000284050.1.21450 WP_000284050.1.21455 WP_000284050.1.21470 WP_000284050.1.21508 WP_000284050.1.21519 WP_000284050.1.21526 WP_000284050.1.2153 WP_000284050.1.21537 WP_000284050.1.2156 WP_000284050.1.21573 WP_000284050.1.21578 WP_000284050.1.21596 WP_000284050.1.21614 WP_000284050.1.21628 WP_000284050.1.21634 WP_000284050.1.21637 WP_000284050.1.2164 WP_000284050.1.21652 WP_000284050.1.21656 WP_000284050.1.21666 WP_000284050.1.21667 WP_000284050.1.21668 WP_000284050.1.21673 WP_000284050.1.21696 WP_000284050.1.21714 WP_000284050.1.21727 WP_000284050.1.21729 WP_000284050.1.21732 WP_000284050.1.21733 WP_000284050.1.21756 WP_000284050.1.21758 WP_000284050.1.21762 WP_000284050.1.21771 WP_000284050.1.21773 WP_000284050.1.21811 WP_000284050.1.21812 WP_000284050.1.21823 WP_000284050.1.21887 WP_000284050.1.21895 WP_000284050.1.21899 WP_000284050.1.21915 WP_000284050.1.21945 WP_000284050.1.21948 WP_000284050.1.21962 WP_000284050.1.2198 WP_000284050.1.21986 WP_000284050.1.21992 WP_000284050.1.22021 WP_000284050.1.22042 WP_000284050.1.22060 WP_000284050.1.22088 WP_000284050.1.22098 WP_000284050.1.22113 WP_000284050.1.22138 WP_000284050.1.22161 WP_000284050.1.2218 WP_000284050.1.22182 WP_000284050.1.22189 WP_000284050.1.22195 WP_000284050.1.22203 WP_000284050.1.22204 WP_000284050.1.22251 WP_000284050.1.22268 WP_000284050.1.22269 WP_000284050.1.22272 WP_000284050.1.22280 WP_000284050.1.22291 WP_000284050.1.22293 WP_000284050.1.22295 WP_000284050.1.22304 WP_000284050.1.22314 WP_000284050.1.2232 WP_000284050.1.22325 WP_000284050.1.22328 WP_000284050.1.22350 WP_000284050.1.22359 WP_000284050.1.22363 WP_000284050.1.22381 WP_000284050.1.22409 WP_000284050.1.2242 WP_000284050.1.22431 WP_000284050.1.2245 WP_000284050.1.22450 WP_000284050.1.22464 WP_000284050.1.22470 WP_000284050.1.22494 WP_000284050.1.22501 WP_000284050.1.22508 WP_000284050.1.22522 WP_000284050.1.22543 WP_000284050.1.22544 WP_000284050.1.22549 WP_000284050.1.22571 WP_000284050.1.22572 WP_000284050.1.22576 WP_000284050.1.22579 WP_000284050.1.22594 WP_000284050.1.22599 WP_000284050.1.22602 WP_000284050.1.22631 WP_000284050.1.22632 WP_000284050.1.22641 WP_000284050.1.22649 WP_000284050.1.22662 WP_000284050.1.22667 WP_000284050.1.22669 WP_000284050.1.22685 WP_000284050.1.22690 WP_000284050.1.22691 WP_000284050.1.22743 WP_000284050.1.22756 WP_000284050.1.22757 WP_000284050.1.22759 WP_000284050.1.22765 WP_000284050.1.22771 WP_000284050.1.22777 WP_000284050.1.22783 WP_000284050.1.22809 WP_000284050.1.22814 WP_000284050.1.22824 WP_000284050.1.22827 WP_000284050.1.22830 WP_000284050.1.22846 WP_000284050.1.22868 WP_000284050.1.22875 WP_000284050.1.22878 WP_000284050.1.22885 WP_000284050.1.22896 WP_000284050.1.22908 WP_000284050.1.22917 WP_000284050.1.22925 WP_000284050.1.22939 WP_000284050.1.22961 WP_000284050.1.22988 WP_000284050.1.22990 WP_000284050.1.22993 WP_000284050.1.2300 WP_000284050.1.23005 WP_000284050.1.23021 WP_000284050.1.23026 WP_000284050.1.23035 WP_000284050.1.23042 WP_000284050.1.23044 WP_000284050.1.23045 WP_000284050.1.23057 WP_000284050.1.23062 WP_000284050.1.23073 WP_000284050.1.23078 WP_000284050.1.23081 WP_000284050.1.23090 WP_000284050.1.23092 WP_000284050.1.23105 WP_000284050.1.23109 WP_000284050.1.23115 WP_000284050.1.23120 WP_000284050.1.23135 WP_000284050.1.2322 WP_000284050.1.23230 WP_000284050.1.23241 WP_000284050.1.2325 WP_000284050.1.23257 WP_000284050.1.23270 WP_000284050.1.23282 WP_000284050.1.23290 WP_000284050.1.23293 WP_000284050.1.23323 WP_000284050.1.23330 WP_000284050.1.23351 WP_000284050.1.23352 WP_000284050.1.23355 WP_000284050.1.23376 WP_000284050.1.23378 WP_000284050.1.23383 WP_000284050.1.23386 WP_000284050.1.23388 WP_000284050.1.23393 WP_000284050.1.23443 WP_000284050.1.23456 WP_000284050.1.23463 WP_000284050.1.23467 WP_000284050.1.23486 WP_000284050.1.23487 WP_000284050.1.23511 WP_000284050.1.23520 WP_000284050.1.23522 WP_000284050.1.23527 WP_000284050.1.2353 WP_000284050.1.23549 WP_000284050.1.23554 WP_000284050.1.23561 WP_000284050.1.23563 WP_000284050.1.23575 WP_000284050.1.23584 WP_000284050.1.23593 WP_000284050.1.2362 WP_000284050.1.23622 WP_000284050.1.23625 WP_000284050.1.23640 WP_000284050.1.23660 WP_000284050.1.23676 WP_000284050.1.23686 WP_000284050.1.23693 WP_000284050.1.23700 WP_000284050.1.23711 WP_000284050.1.23724 WP_000284050.1.23729 WP_000284050.1.23741 WP_000284050.1.23752 WP_000284050.1.23754 WP_000284050.1.23765 WP_000284050.1.23790 WP_000284050.1.23795 WP_000284050.1.23804 WP_000284050.1.23806 WP_000284050.1.23812 WP_000284050.1.23838 WP_000284050.1.23840 WP_000284050.1.23855 WP_000284050.1.2388 WP_000284050.1.23881 WP_000284050.1.23886 WP_000284050.1.23890 WP_000284050.1.23895 WP_000284050.1.23898 WP_000284050.1.23899 WP_000284050.1.23914 WP_000284050.1.23915 WP_000284050.1.23931 WP_000284050.1.23945 WP_000284050.1.2395 WP_000284050.1.23950 WP_000284050.1.23953 WP_000284050.1.23960 WP_000284050.1.23962 WP_000284050.1.23970 WP_000284050.1.23971 WP_000284050.1.23973 WP_000284050.1.23984 WP_000284050.1.23985 WP_000284050.1.24 WP_000284050.1.24004 WP_000284050.1.24024 WP_000284050.1.24038 WP_000284050.1.24045 WP_000284050.1.24051 WP_000284050.1.24058 WP_000284050.1.24068 WP_000284050.1.24070 WP_000284050.1.24088 WP_000284050.1.24089 WP_000284050.1.24120 WP_000284050.1.24122 WP_000284050.1.24124 WP_000284050.1.24127 WP_000284050.1.2413 WP_000284050.1.24136 WP_000284050.1.24169 WP_000284050.1.24177 WP_000284050.1.2418 WP_000284050.1.24194 WP_000284050.1.24233 WP_000284050.1.24278 WP_000284050.1.2428 WP_000284050.1.24283 WP_000284050.1.24290 WP_000284050.1.2430 WP_000284050.1.24304 WP_000284050.1.24316 WP_000284050.1.2433 WP_000284050.1.24341 WP_000284050.1.24362 WP_000284050.1.2437 WP_000284050.1.24374 WP_000284050.1.24381 WP_000284050.1.24383 WP_000284050.1.24458 WP_000284050.1.24460 WP_000284050.1.24473 WP_000284050.1.24483 WP_000284050.1.24485 WP_000284050.1.2449 WP_000284050.1.24499 WP_000284050.1.24523 WP_000284050.1.24524 WP_000284050.1.24533 WP_000284050.1.24536 WP_000284050.1.24547 WP_000284050.1.2456 WP_000284050.1.24560 WP_000284050.1.24570 WP_000284050.1.24575 WP_000284050.1.24583 WP_000284050.1.24592 WP_000284050.1.24616 WP_000284050.1.24634 WP_000284050.1.24641 WP_000284050.1.24642 WP_000284050.1.24646 WP_000284050.1.24650 WP_000284050.1.2469 WP_000284050.1.24693 WP_000284050.1.24695 WP_000284050.1.24752 WP_000284050.1.24753 WP_000284050.1.24758 WP_000284050.1.24773 WP_000284050.1.24783 WP_000284050.1.2479 WP_000284050.1.24791 WP_000284050.1.24797 WP_000284050.1.24799 WP_000284050.1.24808 WP_000284050.1.24849 WP_000284050.1.24854 WP_000284050.1.24870 WP_000284050.1.24876 WP_000284050.1.24899 WP_000284050.1.24902 WP_000284050.1.24906 WP_000284050.1.24909 WP_000284050.1.24926 WP_000284050.1.24929 WP_000284050.1.24939 WP_000284050.1.24946 WP_000284050.1.24960 WP_000284050.1.24968 WP_000284050.1.24979 WP_000284050.1.24981 WP_000284050.1.24982 WP_000284050.1.24984 WP_000284050.1.25019 WP_000284050.1.25021 WP_000284050.1.25038 WP_000284050.1.25039 WP_000284050.1.2504 WP_000284050.1.25042 WP_000284050.1.25050 WP_000284050.1.25060 WP_000284050.1.25076 WP_000284050.1.25079 WP_000284050.1.25082 WP_000284050.1.25085 WP_000284050.1.25086 WP_000284050.1.25087 WP_000284050.1.25088 WP_000284050.1.2512 WP_000284050.1.25126 WP_000284050.1.25141 WP_000284050.1.25174 WP_000284050.1.25183 WP_000284050.1.25193 WP_000284050.1.25201 WP_000284050.1.25203 WP_000284050.1.25204 WP_000284050.1.25248 WP_000284050.1.25270 WP_000284050.1.25272 WP_000284050.1.25289 WP_000284050.1.25305 WP_000284050.1.25312 WP_000284050.1.25324 WP_000284050.1.25346 WP_000284050.1.2537 WP_000284050.1.25372 WP_000284050.1.25378 WP_000284050.1.25380 WP_000284050.1.254 WP_000284050.1.2540 WP_000284050.1.25403 WP_000284050.1.25414 WP_000284050.1.25420 WP_000284050.1.2543 WP_000284050.1.25446 WP_000284050.1.25480 WP_000284050.1.255 WP_000284050.1.25517 WP_000284050.1.25525 WP_000284050.1.25526 WP_000284050.1.25548 WP_000284050.1.25577 WP_000284050.1.2558 WP_000284050.1.25592 WP_000284050.1.25598 WP_000284050.1.25602 WP_000284050.1.25612 WP_000284050.1.25613 WP_000284050.1.25631 WP_000284050.1.25652 WP_000284050.1.2567 WP_000284050.1.25680 WP_000284050.1.25701 WP_000284050.1.25712 WP_000284050.1.25713 WP_000284050.1.25717 WP_000284050.1.25718 WP_000284050.1.25724 WP_000284050.1.25726 WP_000284050.1.25750 WP_000284050.1.25753 WP_000284050.1.25755 WP_000284050.1.25794 WP_000284050.1.25799 WP_000284050.1.25819 WP_000284050.1.25831 WP_000284050.1.25832 WP_000284050.1.25843 WP_000284050.1.25855 WP_000284050.1.25869 WP_000284050.1.25873 WP_000284050.1.2588 WP_000284050.1.25886 WP_000284050.1.2589 WP_000284050.1.25890 WP_000284050.1.25895 WP_000284050.1.25915 WP_000284050.1.25945 WP_000284050.1.2597 WP_000284050.1.25996 WP_000284050.1.26005 WP_000284050.1.26040 WP_000284050.1.26048 WP_000284050.1.26055 WP_000284050.1.2606 WP_000284050.1.26061 WP_000284050.1.26066 WP_000284050.1.26076 WP_000284050.1.26092 WP_000284050.1.26100 WP_000284050.1.26105 WP_000284050.1.2612 WP_000284050.1.26121 WP_000284050.1.26125 WP_000284050.1.26130 WP_000284050.1.26131 WP_000284050.1.26134 WP_000284050.1.26135 WP_000284050.1.26175 WP_000284050.1.26186 WP_000284050.1.26189 WP_000284050.1.26191 WP_000284050.1.26246 WP_000284050.1.26259 WP_000284050.1.26262 WP_000284050.1.26264 WP_000284050.1.26270 WP_000284050.1.26284 WP_000284050.1.26304 WP_000284050.1.26325 WP_000284050.1.26331 WP_000284050.1.2637 WP_000284050.1.26391 WP_000284050.1.26398 WP_000284050.1.26401 WP_000284050.1.26403 WP_000284050.1.26419 WP_000284050.1.2642 WP_000284050.1.26443 WP_000284050.1.26467 WP_000284050.1.26474 WP_000284050.1.26479 WP_000284050.1.26480 WP_000284050.1.26517 WP_000284050.1.26525 WP_000284050.1.26569 WP_000284050.1.26570 WP_000284050.1.26574 WP_000284050.1.26575 WP_000284050.1.26579 WP_000284050.1.26588 WP_000284050.1.26590 WP_000284050.1.26598 WP_000284050.1.26609 WP_000284050.1.26613 WP_000284050.1.26627 WP_000284050.1.26644 WP_000284050.1.2665 WP_000284050.1.26658 WP_000284050.1.26659 WP_000284050.1.26660 WP_000284050.1.26683 WP_000284050.1.26688 WP_000284050.1.26716 WP_000284050.1.26720 WP_000284050.1.26736 WP_000284050.1.26761 WP_000284050.1.26766 WP_000284050.1.26782 WP_000284050.1.26837 WP_000284050.1.26839 WP_000284050.1.26861 WP_000284050.1.26878 WP_000284050.1.2688 WP_000284050.1.26912 WP_000284050.1.26932 WP_000284050.1.2694 WP_000284050.1.26941 WP_000284050.1.26943 WP_000284050.1.2695 WP_000284050.1.26950 WP_000284050.1.26975 WP_000284050.1.26987 WP_000284050.1.26995 WP_000284050.1.26998 WP_000284050.1.2700 WP_000284050.1.27019 WP_000284050.1.27043 WP_000284050.1.27057 WP_000284050.1.27060 WP_000284050.1.27091 WP_000284050.1.27098 WP_000284050.1.27101 WP_000284050.1.27105 WP_000284050.1.2712 WP_000284050.1.27134 WP_000284050.1.27141 WP_000284050.1.27148 WP_000284050.1.27175 WP_000284050.1.27188 WP_000284050.1.27214 WP_000284050.1.27234 WP_000284050.1.27260 WP_000284050.1.27280 WP_000284050.1.27283 WP_000284050.1.27287 WP_000284050.1.27292 WP_000284050.1.2731 WP_000284050.1.27310 WP_000284050.1.27313 WP_000284050.1.27330 WP_000284050.1.27338 WP_000284050.1.27367 WP_000284050.1.27373 WP_000284050.1.27396 WP_000284050.1.27401 WP_000284050.1.27424 WP_000284050.1.27426 WP_000284050.1.27445 WP_000284050.1.2745 WP_000284050.1.27451 WP_000284050.1.27472 WP_000284050.1.27504 WP_000284050.1.27518 WP_000284050.1.27520 WP_000284050.1.27524 WP_000284050.1.27560 WP_000284050.1.27580 WP_000284050.1.27611 WP_000284050.1.27618 WP_000284050.1.27683 WP_000284050.1.27691 WP_000284050.1.27693 WP_000284050.1.27698 WP_000284050.1.27723 WP_000284050.1.27734 WP_000284050.1.27741 WP_000284050.1.27742 WP_000284050.1.27749 WP_000284050.1.27758 WP_000284050.1.27774 WP_000284050.1.27786 WP_000284050.1.2779 WP_000284050.1.2782 WP_000284050.1.27846 WP_000284050.1.27856 WP_000284050.1.27861 WP_000284050.1.27871 WP_000284050.1.27876 WP_000284050.1.27879 WP_000284050.1.27897 WP_000284050.1.27911 WP_000284050.1.27913 WP_000284050.1.27923 WP_000284050.1.27932 WP_000284050.1.2794 WP_000284050.1.27957 WP_000284050.1.27971 WP_000284050.1.27998 WP_000284050.1.28008 WP_000284050.1.28026 WP_000284050.1.28027 WP_000284050.1.28046 WP_000284050.1.28051 WP_000284050.1.28102 WP_000284050.1.28109 WP_000284050.1.2811 WP_000284050.1.28110 WP_000284050.1.28128 WP_000284050.1.28143 WP_000284050.1.28156 WP_000284050.1.28167 WP_000284050.1.28168 WP_000284050.1.28184 WP_000284050.1.28199 WP_000284050.1.2823 WP_000284050.1.28250 WP_000284050.1.2826 WP_000284050.1.28268 WP_000284050.1.28271 WP_000284050.1.28305 WP_000284050.1.28318 WP_000284050.1.28322 WP_000284050.1.28345 WP_000284050.1.28349 WP_000284050.1.28371 WP_000284050.1.2838 WP_000284050.1.28401 WP_000284050.1.28414 WP_000284050.1.28433 WP_000284050.1.28440 WP_000284050.1.28461 WP_000284050.1.28476 WP_000284050.1.28480 WP_000284050.1.28491 WP_000284050.1.28496 WP_000284050.1.285 WP_000284050.1.28500 WP_000284050.1.28509 WP_000284050.1.28523 WP_000284050.1.28536 WP_000284050.1.28540 WP_000284050.1.28544 WP_000284050.1.28551 WP_000284050.1.28554 WP_000284050.1.28568 WP_000284050.1.28639 WP_000284050.1.2866 WP_000284050.1.28662 WP_000284050.1.28683 WP_000284050.1.28697 WP_000284050.1.28711 WP_000284050.1.28723 WP_000284050.1.28732 WP_000284050.1.28734 WP_000284050.1.28736 WP_000284050.1.28742 WP_000284050.1.28760 WP_000284050.1.28762 WP_000284050.1.28769 WP_000284050.1.28791 WP_000284050.1.28809 WP_000284050.1.2881 WP_000284050.1.28829 WP_000284050.1.28835 WP_000284050.1.28842 WP_000284050.1.28863 WP_000284050.1.28879 WP_000284050.1.28919 WP_000284050.1.28924 WP_000284050.1.28950 WP_000284050.1.28953 WP_000284050.1.28982 WP_000284050.1.28994 WP_000284050.1.290 WP_000284050.1.29001 WP_000284050.1.29013 WP_000284050.1.29016 WP_000284050.1.29026 WP_000284050.1.29049 WP_000284050.1.29055 WP_000284050.1.29061 WP_000284050.1.29079 WP_000284050.1.29082 WP_000284050.1.291 WP_000284050.1.29100 WP_000284050.1.29118 WP_000284050.1.29125 WP_000284050.1.29126 WP_000284050.1.29128 WP_000284050.1.29146 WP_000284050.1.29150 WP_000284050.1.29164 WP_000284050.1.29176 WP_000284050.1.29194 WP_000284050.1.29197 WP_000284050.1.29202 WP_000284050.1.29206 WP_000284050.1.29221 WP_000284050.1.29230 WP_000284050.1.29239 WP_000284050.1.29252 WP_000284050.1.29258 WP_000284050.1.2926 WP_000284050.1.2931 WP_000284050.1.29341 WP_000284050.1.29377 WP_000284050.1.29394 WP_000284050.1.29404 WP_000284050.1.2942 WP_000284050.1.29429 WP_000284050.1.2945 WP_000284050.1.29486 WP_000284050.1.29495 WP_000284050.1.29497 WP_000284050.1.29503 WP_000284050.1.29504 WP_000284050.1.29513 WP_000284050.1.2952 WP_000284050.1.29523 WP_000284050.1.2954 WP_000284050.1.29556 WP_000284050.1.29564 WP_000284050.1.29590 WP_000284050.1.29597 WP_000284050.1.29603 WP_000284050.1.29618 WP_000284050.1.2963 WP_000284050.1.29643 WP_000284050.1.29647 WP_000284050.1.29662 WP_000284050.1.29669 WP_000284050.1.29683 WP_000284050.1.29689 WP_000284050.1.29699 WP_000284050.1.29724 WP_000284050.1.29740 WP_000284050.1.29746 WP_000284050.1.29752 WP_000284050.1.2978 WP_000284050.1.29798 WP_000284050.1.29812 WP_000284050.1.29815 WP_000284050.1.29818 WP_000284050.1.29819 WP_000284050.1.29820 WP_000284050.1.29821 WP_000284050.1.29840 WP_000284050.1.29855 WP_000284050.1.29874 WP_000284050.1.29876 WP_000284050.1.29884 WP_000284050.1.29893 WP_000284050.1.29933 WP_000284050.1.2995 WP_000284050.1.29967 WP_000284050.1.29976 WP_000284050.1.29979 WP_000284050.1.29988 WP_000284050.1.29992 WP_000284050.1.30 WP_000284050.1.30004 WP_000284050.1.30016 WP_000284050.1.30019 WP_000284050.1.30035 WP_000284050.1.30052 WP_000284050.1.30063 WP_000284050.1.30064 WP_000284050.1.30098 WP_000284050.1.30105 WP_000284050.1.30123 WP_000284050.1.30141 WP_000284050.1.30164 WP_000284050.1.30178 WP_000284050.1.3018 WP_000284050.1.30221 WP_000284050.1.30222 WP_000284050.1.30231 WP_000284050.1.30232 WP_000284050.1.30239 WP_000284050.1.30253 WP_000284050.1.30269 WP_000284050.1.30298 WP_000284050.1.30347 WP_000284050.1.30391 WP_000284050.1.30399 WP_000284050.1.30400 WP_000284050.1.30401 WP_000284050.1.30428 WP_000284050.1.30447 WP_000284050.1.30452 WP_000284050.1.30472 WP_000284050.1.30476 WP_000284050.1.30497 WP_000284050.1.30524 WP_000284050.1.30546 WP_000284050.1.3055 WP_000284050.1.30554 WP_000284050.1.30570 WP_000284050.1.30580 WP_000284050.1.306 WP_000284050.1.3063 WP_000284050.1.30630 WP_000284050.1.30637 WP_000284050.1.30639 WP_000284050.1.30640 WP_000284050.1.30658 WP_000284050.1.30665 WP_000284050.1.30691 WP_000284050.1.30700 WP_000284050.1.30733 WP_000284050.1.30742 WP_000284050.1.30749 WP_000284050.1.30762 WP_000284050.1.30783 WP_000284050.1.30808 WP_000284050.1.3083 WP_000284050.1.30843 WP_000284050.1.30853 WP_000284050.1.30866 WP_000284050.1.30867 WP_000284050.1.30879 WP_000284050.1.30887 WP_000284050.1.30896 WP_000284050.1.309 WP_000284050.1.30905 WP_000284050.1.30906 WP_000284050.1.30918 WP_000284050.1.30960 WP_000284050.1.30987 WP_000284050.1.30993 WP_000284050.1.30999 WP_000284050.1.31000 WP_000284050.1.31009 WP_000284050.1.31017 WP_000284050.1.31026 WP_000284050.1.31055 WP_000284050.1.31083 WP_000284050.1.31089 WP_000284050.1.31119 WP_000284050.1.31129 WP_000284050.1.31142 WP_000284050.1.31149 WP_000284050.1.31154 WP_000284050.1.31188 WP_000284050.1.312 WP_000284050.1.31211 WP_000284050.1.31252 WP_000284050.1.31295 WP_000284050.1.31319 WP_000284050.1.31340 WP_000284050.1.31347 WP_000284050.1.31353 WP_000284050.1.31357 WP_000284050.1.31372 WP_000284050.1.31379 WP_000284050.1.3140 WP_000284050.1.31401 WP_000284050.1.31407 WP_000284050.1.31419 WP_000284050.1.31421 WP_000284050.1.31422 WP_000284050.1.31429 WP_000284050.1.31431 WP_000284050.1.31434 WP_000284050.1.3147 WP_000284050.1.31482 WP_000284050.1.31506 WP_000284050.1.31511 WP_000284050.1.31518 WP_000284050.1.31521 WP_000284050.1.31527 WP_000284050.1.31542 WP_000284050.1.31557 WP_000284050.1.31559 WP_000284050.1.31575 WP_000284050.1.31596 WP_000284050.1.31614 WP_000284050.1.31618 WP_000284050.1.31625 WP_000284050.1.31639 WP_000284050.1.31657 WP_000284050.1.31675 WP_000284050.1.31679 WP_000284050.1.31681 WP_000284050.1.3169 WP_000284050.1.31696 WP_000284050.1.31709 WP_000284050.1.31715 WP_000284050.1.31736 WP_000284050.1.31740 WP_000284050.1.3176 WP_000284050.1.31801 WP_000284050.1.31803 WP_000284050.1.31809 WP_000284050.1.3181 WP_000284050.1.31823 WP_000284050.1.31825 WP_000284050.1.31833 WP_000284050.1.31835 WP_000284050.1.31839 WP_000284050.1.31860 WP_000284050.1.31863 WP_000284050.1.31866 WP_000284050.1.31878 WP_000284050.1.31898 WP_000284050.1.31899 WP_000284050.1.31903 WP_000284050.1.31924 WP_000284050.1.31928 WP_000284050.1.3193 WP_000284050.1.31937 WP_000284050.1.31956 WP_000284050.1.31978 WP_000284050.1.3201 WP_000284050.1.32020 WP_000284050.1.32021 WP_000284050.1.32024 WP_000284050.1.3203 WP_000284050.1.32037 WP_000284050.1.32049 WP_000284050.1.32063 WP_000284050.1.32078 WP_000284050.1.32089 WP_000284050.1.32091 WP_000284050.1.32093 WP_000284050.1.32094 WP_000284050.1.3212 WP_000284050.1.32121 WP_000284050.1.32127 WP_000284050.1.32138 WP_000284050.1.32142 WP_000284050.1.32143 WP_000284050.1.3215 WP_000284050.1.32173 WP_000284050.1.32184 WP_000284050.1.322 WP_000284050.1.32225 WP_000284050.1.32232 WP_000284050.1.32234 WP_000284050.1.32236 WP_000284050.1.32242 WP_000284050.1.32243 WP_000284050.1.32279 WP_000284050.1.32287 WP_000284050.1.3233 WP_000284050.1.32333 WP_000284050.1.32394 WP_000284050.1.32406 WP_000284050.1.32432 WP_000284050.1.32435 WP_000284050.1.32443 WP_000284050.1.32448 WP_000284050.1.3247 WP_000284050.1.32475 WP_000284050.1.32478 WP_000284050.1.32479 WP_000284050.1.3248 WP_000284050.1.32480 WP_000284050.1.32494 WP_000284050.1.32509 WP_000284050.1.32518 WP_000284050.1.32536 WP_000284050.1.32558 WP_000284050.1.32561 WP_000284050.1.32574 WP_000284050.1.32580 WP_000284050.1.32587 WP_000284050.1.3259 WP_000284050.1.32590 WP_000284050.1.32591 WP_000284050.1.32601 WP_000284050.1.32635 WP_000284050.1.32655 WP_000284050.1.32661 WP_000284050.1.32676 WP_000284050.1.32680 WP_000284050.1.3269 WP_000284050.1.327 WP_000284050.1.32709 WP_000284050.1.32715 WP_000284050.1.32718 WP_000284050.1.32720 WP_000284050.1.32722 WP_000284050.1.32724 WP_000284050.1.32741 WP_000284050.1.32748 WP_000284050.1.32772 WP_000284050.1.32811 WP_000284050.1.32815 WP_000284050.1.32831 WP_000284050.1.32875 WP_000284050.1.32888 WP_000284050.1.32903 WP_000284050.1.32910 WP_000284050.1.32931 WP_000284050.1.32938 WP_000284050.1.32946 WP_000284050.1.3295 WP_000284050.1.32959 WP_000284050.1.32972 WP_000284050.1.32984 WP_000284050.1.32992 WP_000284050.1.32995 WP_000284050.1.33004 WP_000284050.1.33014 WP_000284050.1.33018 WP_000284050.1.33022 WP_000284050.1.33046 WP_000284050.1.33049 WP_000284050.1.33053 WP_000284050.1.33055 WP_000284050.1.33094 WP_000284050.1.33101 WP_000284050.1.33119 WP_000284050.1.33125 WP_000284050.1.33146 WP_000284050.1.33167 WP_000284050.1.33171 WP_000284050.1.33178 WP_000284050.1.33179 WP_000284050.1.33190 WP_000284050.1.33217 WP_000284050.1.33222 WP_000284050.1.3323 WP_000284050.1.33237 WP_000284050.1.33238 WP_000284050.1.33244 WP_000284050.1.33268 WP_000284050.1.33303 WP_000284050.1.33325 WP_000284050.1.33341 WP_000284050.1.33352 WP_000284050.1.33362 WP_000284050.1.33369 WP_000284050.1.33385 WP_000284050.1.334 WP_000284050.1.33408 WP_000284050.1.33410 WP_000284050.1.33413 WP_000284050.1.33422 WP_000284050.1.33424 WP_000284050.1.33428 WP_000284050.1.3344 WP_000284050.1.33475 WP_000284050.1.33476 WP_000284050.1.33502 WP_000284050.1.33512 WP_000284050.1.33526 WP_000284050.1.3354 WP_000284050.1.33545 WP_000284050.1.33561 WP_000284050.1.33563 WP_000284050.1.33565 WP_000284050.1.33584 WP_000284050.1.33595 WP_000284050.1.33631 WP_000284050.1.33638 WP_000284050.1.33648 WP_000284050.1.33667 WP_000284050.1.33680 WP_000284050.1.33729 WP_000284050.1.33736 WP_000284050.1.33745 WP_000284050.1.33746 WP_000284050.1.33751 WP_000284050.1.33780 WP_000284050.1.33799 WP_000284050.1.33823 WP_000284050.1.33853 WP_000284050.1.33854 WP_000284050.1.33888 WP_000284050.1.33896 WP_000284050.1.33914 WP_000284050.1.33948 WP_000284050.1.33952 WP_000284050.1.33973 WP_000284050.1.33974 WP_000284050.1.33979 WP_000284050.1.3398 WP_000284050.1.33981 WP_000284050.1.34003 WP_000284050.1.3401 WP_000284050.1.34032 WP_000284050.1.34094 WP_000284050.1.3411 WP_000284050.1.34117 WP_000284050.1.34121 WP_000284050.1.34122 WP_000284050.1.34124 WP_000284050.1.34130 WP_000284050.1.34144 WP_000284050.1.3415 WP_000284050.1.342 WP_000284050.1.34204 WP_000284050.1.34206 WP_000284050.1.34208 WP_000284050.1.34224 WP_000284050.1.34269 WP_000284050.1.34270 WP_000284050.1.34273 WP_000284050.1.34294 WP_000284050.1.34303 WP_000284050.1.3432 WP_000284050.1.34332 WP_000284050.1.34341 WP_000284050.1.34348 WP_000284050.1.34362 WP_000284050.1.34363 WP_000284050.1.34380 WP_000284050.1.34383 WP_000284050.1.3439 WP_000284050.1.34397 WP_000284050.1.34400 WP_000284050.1.34422 WP_000284050.1.3444 WP_000284050.1.34440 WP_000284050.1.34441 WP_000284050.1.34444 WP_000284050.1.34456 WP_000284050.1.34464 WP_000284050.1.34470 WP_000284050.1.34500 WP_000284050.1.34525 WP_000284050.1.34528 WP_000284050.1.34532 WP_000284050.1.34538 WP_000284050.1.34541 WP_000284050.1.34557 WP_000284050.1.34558 WP_000284050.1.3460 WP_000284050.1.34605 WP_000284050.1.34617 WP_000284050.1.34655 WP_000284050.1.34668 WP_000284050.1.34675 WP_000284050.1.34680 WP_000284050.1.34682 WP_000284050.1.34683 WP_000284050.1.34686 WP_000284050.1.3469 WP_000284050.1.347 WP_000284050.1.3472 WP_000284050.1.34727 WP_000284050.1.34763 WP_000284050.1.34781 WP_000284050.1.34782 WP_000284050.1.34794 WP_000284050.1.34827 WP_000284050.1.34835 WP_000284050.1.34838 WP_000284050.1.34855 WP_000284050.1.34875 WP_000284050.1.34887 WP_000284050.1.34913 WP_000284050.1.34931 WP_000284050.1.34948 WP_000284050.1.34966 WP_000284050.1.34982 WP_000284050.1.34983 WP_000284050.1.34990 WP_000284050.1.34993 WP_000284050.1.35003 WP_000284050.1.35006 WP_000284050.1.35007 WP_000284050.1.35012 WP_000284050.1.35039 WP_000284050.1.35107 WP_000284050.1.35127 WP_000284050.1.35132 WP_000284050.1.3515 WP_000284050.1.35168 WP_000284050.1.35180 WP_000284050.1.35186 WP_000284050.1.35195 WP_000284050.1.35198 WP_000284050.1.35202 WP_000284050.1.35204 WP_000284050.1.35208 WP_000284050.1.3521 WP_000284050.1.35211 WP_000284050.1.35220 WP_000284050.1.35253 WP_000284050.1.35258 WP_000284050.1.35316 WP_000284050.1.35328 WP_000284050.1.35360 WP_000284050.1.35365 WP_000284050.1.35368 WP_000284050.1.35376 WP_000284050.1.3539 WP_000284050.1.35393 WP_000284050.1.35394 WP_000284050.1.35398 WP_000284050.1.35448 WP_000284050.1.35464 WP_000284050.1.35465 WP_000284050.1.35466 WP_000284050.1.35468 WP_000284050.1.3550 WP_000284050.1.35552 WP_000284050.1.35578 WP_000284050.1.35581 WP_000284050.1.3560 WP_000284050.1.35604 WP_000284050.1.35627 WP_000284050.1.35632 WP_000284050.1.35649 WP_000284050.1.35651 WP_000284050.1.35653 WP_000284050.1.35654 WP_000284050.1.35698 WP_000284050.1.35704 WP_000284050.1.35724 WP_000284050.1.35740 WP_000284050.1.35741 WP_000284050.1.35744 WP_000284050.1.35789 WP_000284050.1.35889 WP_000284050.1.35904 WP_000284050.1.35922 WP_000284050.1.35927 WP_000284050.1.35934 WP_000284050.1.35942 WP_000284050.1.35959 WP_000284050.1.35963 WP_000284050.1.3598 WP_000284050.1.35987 WP_000284050.1.35990 WP_000284050.1.3600 WP_000284050.1.36010 WP_000284050.1.36040 WP_000284050.1.36042 WP_000284050.1.36070 WP_000284050.1.36071 WP_000284050.1.36085 WP_000284050.1.36094 WP_000284050.1.36105 WP_000284050.1.36129 WP_000284050.1.36132 WP_000284050.1.36158 WP_000284050.1.36159 WP_000284050.1.36164 WP_000284050.1.36166 WP_000284050.1.36177 WP_000284050.1.36182 WP_000284050.1.3620 WP_000284050.1.36207 WP_000284050.1.36212 WP_000284050.1.3624 WP_000284050.1.36281 WP_000284050.1.36299 WP_000284050.1.36332 WP_000284050.1.36334 WP_000284050.1.36352 WP_000284050.1.36386 WP_000284050.1.36393 WP_000284050.1.36405 WP_000284050.1.36412 WP_000284050.1.36414 WP_000284050.1.36426 WP_000284050.1.3643 WP_000284050.1.36453 WP_000284050.1.36459 WP_000284050.1.36496 WP_000284050.1.365 WP_000284050.1.36500 WP_000284050.1.36507 WP_000284050.1.36523 WP_000284050.1.36531 WP_000284050.1.36537 WP_000284050.1.36545 WP_000284050.1.36610 WP_000284050.1.36626 WP_000284050.1.36627 WP_000284050.1.36628 WP_000284050.1.36667 WP_000284050.1.3668 WP_000284050.1.36699 WP_000284050.1.36707 WP_000284050.1.3671 WP_000284050.1.36724 WP_000284050.1.36739 WP_000284050.1.36746 WP_000284050.1.36747 WP_000284050.1.36761 WP_000284050.1.36767 WP_000284050.1.36799 WP_000284050.1.36806 WP_000284050.1.36812 WP_000284050.1.36817 WP_000284050.1.36826 WP_000284050.1.36833 WP_000284050.1.36856 WP_000284050.1.36886 WP_000284050.1.36894 WP_000284050.1.36904 WP_000284050.1.36925 WP_000284050.1.3697 WP_000284050.1.36971 WP_000284050.1.36975 WP_000284050.1.37006 WP_000284050.1.37020 WP_000284050.1.37032 WP_000284050.1.37046 WP_000284050.1.37049 WP_000284050.1.37057 WP_000284050.1.37076 WP_000284050.1.37099 WP_000284050.1.37101 WP_000284050.1.37102 WP_000284050.1.37103 WP_000284050.1.37122 WP_000284050.1.37146 WP_000284050.1.37153 WP_000284050.1.37155 WP_000284050.1.37206 WP_000284050.1.37226 WP_000284050.1.3723 WP_000284050.1.37233 WP_000284050.1.37252 WP_000284050.1.37261 WP_000284050.1.37266 WP_000284050.1.37290 WP_000284050.1.3730 WP_000284050.1.37306 WP_000284050.1.37312 WP_000284050.1.37313 WP_000284050.1.37329 WP_000284050.1.37334 WP_000284050.1.37337 WP_000284050.1.37342 WP_000284050.1.37352 WP_000284050.1.37360 WP_000284050.1.37371 WP_000284050.1.37372 WP_000284050.1.37388 WP_000284050.1.37419 WP_000284050.1.37423 WP_000284050.1.37433 WP_000284050.1.37445 WP_000284050.1.37472 WP_000284050.1.37476 WP_000284050.1.37477 WP_000284050.1.37485 WP_000284050.1.3749 WP_000284050.1.37510 WP_000284050.1.37516 WP_000284050.1.37538 WP_000284050.1.37543 WP_000284050.1.37544 WP_000284050.1.37548 WP_000284050.1.37549 WP_000284050.1.37550 WP_000284050.1.37554 WP_000284050.1.37576 WP_000284050.1.37588 WP_000284050.1.37592 WP_000284050.1.37608 WP_000284050.1.3762 WP_000284050.1.37634 WP_000284050.1.37637 WP_000284050.1.37664 WP_000284050.1.377 WP_000284050.1.3772 WP_000284050.1.37730 WP_000284050.1.37731 WP_000284050.1.37736 WP_000284050.1.37745 WP_000284050.1.37750 WP_000284050.1.37758 WP_000284050.1.37762 WP_000284050.1.37766 WP_000284050.1.37769 WP_000284050.1.37773 WP_000284050.1.37817 WP_000284050.1.37830 WP_000284050.1.37847 WP_000284050.1.37852 WP_000284050.1.37853 WP_000284050.1.3788 WP_000284050.1.37880 WP_000284050.1.37887 WP_000284050.1.37897 WP_000284050.1.37917 WP_000284050.1.37923 WP_000284050.1.37926 WP_000284050.1.37940 WP_000284050.1.3795 WP_000284050.1.37962 WP_000284050.1.37964 WP_000284050.1.37967 WP_000284050.1.37984 WP_000284050.1.37995 WP_000284050.1.37998 WP_000284050.1.38000 WP_000284050.1.38033 WP_000284050.1.38043 WP_000284050.1.38050 WP_000284050.1.38063 WP_000284050.1.38080 WP_000284050.1.38081 WP_000284050.1.38085 WP_000284050.1.38103 WP_000284050.1.38105 WP_000284050.1.38107 WP_000284050.1.3811 WP_000284050.1.38119 WP_000284050.1.38120 WP_000284050.1.3815 WP_000284050.1.38155 WP_000284050.1.38162 WP_000284050.1.38182 WP_000284050.1.38185 WP_000284050.1.38194 WP_000284050.1.38202 WP_000284050.1.38211 WP_000284050.1.3822 WP_000284050.1.38234 WP_000284050.1.38257 WP_000284050.1.38264 WP_000284050.1.38293 WP_000284050.1.38300 WP_000284050.1.38306 WP_000284050.1.38314 WP_000284050.1.38323 WP_000284050.1.38357 WP_000284050.1.38363 WP_000284050.1.38369 WP_000284050.1.38371 WP_000284050.1.38392 WP_000284050.1.38412 WP_000284050.1.38419 WP_000284050.1.38485 WP_000284050.1.38533 WP_000284050.1.38544 WP_000284050.1.38561 WP_000284050.1.38567 WP_000284050.1.38584 WP_000284050.1.38610 WP_000284050.1.38626 WP_000284050.1.38629 WP_000284050.1.38636 WP_000284050.1.38694 WP_000284050.1.38722 WP_000284050.1.3873 WP_000284050.1.38751 WP_000284050.1.38777 WP_000284050.1.38782 WP_000284050.1.38811 WP_000284050.1.38827 WP_000284050.1.38835 WP_000284050.1.38843 WP_000284050.1.38896 WP_000284050.1.389 WP_000284050.1.38911 WP_000284050.1.38920 WP_000284050.1.38935 WP_000284050.1.38937 WP_000284050.1.38950 WP_000284050.1.38956 WP_000284050.1.38958 WP_000284050.1.39005 WP_000284050.1.39015 WP_000284050.1.3903 WP_000284050.1.39037 WP_000284050.1.3904 WP_000284050.1.39042 WP_000284050.1.39063 WP_000284050.1.39103 WP_000284050.1.39111 WP_000284050.1.3912 WP_000284050.1.39123 WP_000284050.1.39148 WP_000284050.1.39150 WP_000284050.1.39155 WP_000284050.1.39157 WP_000284050.1.39164 WP_000284050.1.39167 WP_000284050.1.39171 WP_000284050.1.39180 WP_000284050.1.39184 WP_000284050.1.39196 WP_000284050.1.39209 WP_000284050.1.3921 WP_000284050.1.3922 WP_000284050.1.39232 WP_000284050.1.39249 WP_000284050.1.39254 WP_000284050.1.39268 WP_000284050.1.39286 WP_000284050.1.39289 WP_000284050.1.39302 WP_000284050.1.39305 WP_000284050.1.39310 WP_000284050.1.39313 WP_000284050.1.39325 WP_000284050.1.39327 WP_000284050.1.39335 WP_000284050.1.39342 WP_000284050.1.39356 WP_000284050.1.39358 WP_000284050.1.39365 WP_000284050.1.39367 WP_000284050.1.39373 WP_000284050.1.39377 WP_000284050.1.39401 WP_000284050.1.39402 WP_000284050.1.39415 WP_000284050.1.39423 WP_000284050.1.39430 WP_000284050.1.39468 WP_000284050.1.39481 WP_000284050.1.39492 WP_000284050.1.39509 WP_000284050.1.39531 WP_000284050.1.3954 WP_000284050.1.39541 WP_000284050.1.39564 WP_000284050.1.39575 WP_000284050.1.39580 WP_000284050.1.39594 WP_000284050.1.39601 WP_000284050.1.39606 WP_000284050.1.39607 WP_000284050.1.39610 WP_000284050.1.39626 WP_000284050.1.39636 WP_000284050.1.39646 WP_000284050.1.39651 WP_000284050.1.39690 WP_000284050.1.3970 WP_000284050.1.39708 WP_000284050.1.39709 WP_000284050.1.39713 WP_000284050.1.39715 WP_000284050.1.39717 WP_000284050.1.39726 WP_000284050.1.39730 WP_000284050.1.39733 WP_000284050.1.39734 WP_000284050.1.39780 WP_000284050.1.39796 WP_000284050.1.3980 WP_000284050.1.39809 WP_000284050.1.39818 WP_000284050.1.39820 WP_000284050.1.39822 WP_000284050.1.39829 WP_000284050.1.39867 WP_000284050.1.39870 WP_000284050.1.39892 WP_000284050.1.39938 WP_000284050.1.39961 WP_000284050.1.39966 WP_000284050.1.39970 WP_000284050.1.39973 WP_000284050.1.39992 WP_000284050.1.39998 WP_000284050.1.40013 WP_000284050.1.40016 WP_000284050.1.40019 WP_000284050.1.4005 WP_000284050.1.40083 WP_000284050.1.40088 WP_000284050.1.40107 WP_000284050.1.40113 WP_000284050.1.40121 WP_000284050.1.40147 WP_000284050.1.40153 WP_000284050.1.40159 WP_000284050.1.40183 WP_000284050.1.40190 WP_000284050.1.40192 WP_000284050.1.4020 WP_000284050.1.40206 WP_000284050.1.40211 WP_000284050.1.40212 WP_000284050.1.40218 WP_000284050.1.40234 WP_000284050.1.40238 WP_000284050.1.40249 WP_000284050.1.40298 WP_000284050.1.4030 WP_000284050.1.40300 WP_000284050.1.40315 WP_000284050.1.40317 WP_000284050.1.40319 WP_000284050.1.40335 WP_000284050.1.40345 WP_000284050.1.40349 WP_000284050.1.40360 WP_000284050.1.40382 WP_000284050.1.40389 WP_000284050.1.40391 WP_000284050.1.40403 WP_000284050.1.40445 WP_000284050.1.40486 WP_000284050.1.4049 WP_000284050.1.40499 WP_000284050.1.40502 WP_000284050.1.40509 WP_000284050.1.40524 WP_000284050.1.40539 WP_000284050.1.40548 WP_000284050.1.40549 WP_000284050.1.40560 WP_000284050.1.40563 WP_000284050.1.40596 WP_000284050.1.40599 WP_000284050.1.406 WP_000284050.1.40607 WP_000284050.1.40617 WP_000284050.1.40623 WP_000284050.1.40629 WP_000284050.1.40636 WP_000284050.1.40657 WP_000284050.1.40660 WP_000284050.1.40668 WP_000284050.1.40686 WP_000284050.1.40712 WP_000284050.1.40715 WP_000284050.1.40742 WP_000284050.1.40758 WP_000284050.1.40781 WP_000284050.1.40793 WP_000284050.1.4081 WP_000284050.1.40813 WP_000284050.1.40815 WP_000284050.1.4082 WP_000284050.1.40842 WP_000284050.1.40843 WP_000284050.1.40865 WP_000284050.1.40882 WP_000284050.1.40893 WP_000284050.1.40900 WP_000284050.1.40912 WP_000284050.1.40952 WP_000284050.1.40965 WP_000284050.1.4103 WP_000284050.1.41037 WP_000284050.1.41041 WP_000284050.1.41045 WP_000284050.1.41060 WP_000284050.1.41063 WP_000284050.1.41078 WP_000284050.1.41113 WP_000284050.1.41125 WP_000284050.1.41147 WP_000284050.1.41206 WP_000284050.1.4122 WP_000284050.1.41230 WP_000284050.1.41239 WP_000284050.1.41244 WP_000284050.1.41259 WP_000284050.1.4126 WP_000284050.1.41263 WP_000284050.1.41271 WP_000284050.1.41287 WP_000284050.1.41294 WP_000284050.1.41315 WP_000284050.1.41330 WP_000284050.1.41332 WP_000284050.1.41339 WP_000284050.1.41346 WP_000284050.1.41363 WP_000284050.1.41368 WP_000284050.1.41371 WP_000284050.1.41391 WP_000284050.1.41392 WP_000284050.1.41394 WP_000284050.1.41401 WP_000284050.1.41402 WP_000284050.1.41407 WP_000284050.1.41417 WP_000284050.1.4142 WP_000284050.1.41436 WP_000284050.1.41449 WP_000284050.1.41453 WP_000284050.1.41455 WP_000284050.1.41457 WP_000284050.1.41466 WP_000284050.1.41478 WP_000284050.1.41482 WP_000284050.1.41483 WP_000284050.1.41484 WP_000284050.1.41488 WP_000284050.1.41513 WP_000284050.1.41530 WP_000284050.1.41536 WP_000284050.1.41539 WP_000284050.1.41545 WP_000284050.1.41556 WP_000284050.1.41566 WP_000284050.1.4158 WP_000284050.1.41606 WP_000284050.1.41613 WP_000284050.1.41621 WP_000284050.1.41651 WP_000284050.1.41654 WP_000284050.1.41712 WP_000284050.1.41718 WP_000284050.1.4172 WP_000284050.1.41734 WP_000284050.1.41740 WP_000284050.1.41741 WP_000284050.1.41752 WP_000284050.1.41778 WP_000284050.1.41780 WP_000284050.1.41782 WP_000284050.1.41783 WP_000284050.1.41784 WP_000284050.1.41809 WP_000284050.1.41812 WP_000284050.1.41813 WP_000284050.1.41822 WP_000284050.1.41826 WP_000284050.1.41837 WP_000284050.1.41847 WP_000284050.1.41849 WP_000284050.1.41884 WP_000284050.1.41885 WP_000284050.1.4189 WP_000284050.1.41900 WP_000284050.1.41923 WP_000284050.1.4193 WP_000284050.1.41956 WP_000284050.1.41960 WP_000284050.1.41964 WP_000284050.1.41988 WP_000284050.1.41990 WP_000284050.1.41991 WP_000284050.1.42022 WP_000284050.1.42033 WP_000284050.1.42036 WP_000284050.1.42038 WP_000284050.1.42044 WP_000284050.1.42060 WP_000284050.1.42073 WP_000284050.1.42095 WP_000284050.1.42096 WP_000284050.1.42113 WP_000284050.1.4213 WP_000284050.1.42138 WP_000284050.1.4214 WP_000284050.1.42151 WP_000284050.1.42159 WP_000284050.1.42179 WP_000284050.1.42191 WP_000284050.1.42203 WP_000284050.1.42209 WP_000284050.1.42214 WP_000284050.1.42221 WP_000284050.1.42226 WP_000284050.1.42228 WP_000284050.1.42233 WP_000284050.1.4224 WP_000284050.1.42252 WP_000284050.1.42258 WP_000284050.1.42277 WP_000284050.1.42284 WP_000284050.1.42300 WP_000284050.1.42318 WP_000284050.1.42350 WP_000284050.1.42359 WP_000284050.1.42367 WP_000284050.1.42369 WP_000284050.1.42376 WP_000284050.1.42387 WP_000284050.1.42413 WP_000284050.1.42415 WP_000284050.1.4242 WP_000284050.1.42432 WP_000284050.1.42442 WP_000284050.1.42443 WP_000284050.1.42447 WP_000284050.1.42448 WP_000284050.1.42456 WP_000284050.1.42480 WP_000284050.1.4250 WP_000284050.1.42513 WP_000284050.1.42516 WP_000284050.1.42522 WP_000284050.1.42586 WP_000284050.1.42594 WP_000284050.1.42597 WP_000284050.1.42600 WP_000284050.1.42601 WP_000284050.1.4261 WP_000284050.1.42632 WP_000284050.1.42638 WP_000284050.1.42661 WP_000284050.1.42669 WP_000284050.1.42670 WP_000284050.1.42677 WP_000284050.1.42709 WP_000284050.1.42728 WP_000284050.1.42748 WP_000284050.1.42749 WP_000284050.1.42750 WP_000284050.1.42756 WP_000284050.1.42761 WP_000284050.1.42770 WP_000284050.1.42771 WP_000284050.1.42791 WP_000284050.1.42804 WP_000284050.1.42808 WP_000284050.1.42813 WP_000284050.1.4282 WP_000284050.1.42828 WP_000284050.1.42830 WP_000284050.1.42832 WP_000284050.1.42863 WP_000284050.1.42879 WP_000284050.1.42891 WP_000284050.1.4290 WP_000284050.1.42903 WP_000284050.1.42936 WP_000284050.1.42937 WP_000284050.1.42950 WP_000284050.1.42962 WP_000284050.1.42966 WP_000284050.1.42970 WP_000284050.1.42975 WP_000284050.1.42987 WP_000284050.1.42989 WP_000284050.1.42991 WP_000284050.1.43013 WP_000284050.1.43027 WP_000284050.1.43035 WP_000284050.1.4306 WP_000284050.1.43079 WP_000284050.1.43121 WP_000284050.1.43123 WP_000284050.1.4313 WP_000284050.1.43132 WP_000284050.1.43133 WP_000284050.1.43137 WP_000284050.1.43140 WP_000284050.1.43166 WP_000284050.1.43170 WP_000284050.1.43174 WP_000284050.1.43177 WP_000284050.1.43196 WP_000284050.1.43213 WP_000284050.1.43239 WP_000284050.1.43270 WP_000284050.1.43278 WP_000284050.1.43316 WP_000284050.1.43324 WP_000284050.1.4334 WP_000284050.1.43363 WP_000284050.1.43374 WP_000284050.1.43384 WP_000284050.1.43389 WP_000284050.1.4342 WP_000284050.1.43422 WP_000284050.1.43427 WP_000284050.1.4343 WP_000284050.1.43444 WP_000284050.1.43448 WP_000284050.1.43455 WP_000284050.1.43469 WP_000284050.1.43473 WP_000284050.1.43474 WP_000284050.1.43489 WP_000284050.1.43501 WP_000284050.1.43536 WP_000284050.1.4356 WP_000284050.1.43561 WP_000284050.1.43566 WP_000284050.1.43598 WP_000284050.1.436 WP_000284050.1.43604 WP_000284050.1.43622 WP_000284050.1.43642 WP_000284050.1.43720 WP_000284050.1.43733 WP_000284050.1.43738 WP_000284050.1.43750 WP_000284050.1.43754 WP_000284050.1.43769 WP_000284050.1.43798 WP_000284050.1.43803 WP_000284050.1.43804 WP_000284050.1.43816 WP_000284050.1.43837 WP_000284050.1.43858 WP_000284050.1.43868 WP_000284050.1.43898 WP_000284050.1.43911 WP_000284050.1.43939 WP_000284050.1.43942 WP_000284050.1.43953 WP_000284050.1.43966 WP_000284050.1.43989 WP_000284050.1.440 WP_000284050.1.4400 WP_000284050.1.44018 WP_000284050.1.44020 WP_000284050.1.44029 WP_000284050.1.44040 WP_000284050.1.44051 WP_000284050.1.44075 WP_000284050.1.44077 WP_000284050.1.44088 WP_000284050.1.44096 WP_000284050.1.44100 WP_000284050.1.4411 WP_000284050.1.44115 WP_000284050.1.44125 WP_000284050.1.4415 WP_000284050.1.44162 WP_000284050.1.44165 WP_000284050.1.44166 WP_000284050.1.44201 WP_000284050.1.44203 WP_000284050.1.44211 WP_000284050.1.44222 WP_000284050.1.44238 WP_000284050.1.44251 WP_000284050.1.44263 WP_000284050.1.44264 WP_000284050.1.44273 WP_000284050.1.44285 WP_000284050.1.44287 WP_000284050.1.44292 WP_000284050.1.44314 WP_000284050.1.44324 WP_000284050.1.44327 WP_000284050.1.44354 WP_000284050.1.44365 WP_000284050.1.44389 WP_000284050.1.44394 WP_000284050.1.44424 WP_000284050.1.44426 WP_000284050.1.44445 WP_000284050.1.44447 WP_000284050.1.4445 WP_000284050.1.44452 WP_000284050.1.44458 WP_000284050.1.44460 WP_000284050.1.44461 WP_000284050.1.44488 WP_000284050.1.4449 WP_000284050.1.44524 WP_000284050.1.44539 WP_000284050.1.4454 WP_000284050.1.44558 WP_000284050.1.44561 WP_000284050.1.44570 WP_000284050.1.44587 WP_000284050.1.4459 WP_000284050.1.44608 WP_000284050.1.44610 WP_000284050.1.44622 WP_000284050.1.44627 WP_000284050.1.4463 WP_000284050.1.44642 WP_000284050.1.44649 WP_000284050.1.44661 WP_000284050.1.44668 WP_000284050.1.44671 WP_000284050.1.44686 WP_000284050.1.4471 WP_000284050.1.44717 WP_000284050.1.44724 WP_000284050.1.4473 WP_000284050.1.44733 WP_000284050.1.44756 WP_000284050.1.44784 WP_000284050.1.448 WP_000284050.1.44800 WP_000284050.1.44814 WP_000284050.1.44818 WP_000284050.1.44821 WP_000284050.1.44836 WP_000284050.1.44840 WP_000284050.1.44841 WP_000284050.1.44843 WP_000284050.1.44848 WP_000284050.1.44849 WP_000284050.1.44854 WP_000284050.1.44855 WP_000284050.1.44857 WP_000284050.1.44906 WP_000284050.1.44923 WP_000284050.1.44954 WP_000284050.1.44960 WP_000284050.1.44961 WP_000284050.1.44970 WP_000284050.1.44975 WP_000284050.1.44977 WP_000284050.1.44980 WP_000284050.1.45000 WP_000284050.1.45020 WP_000284050.1.45025 WP_000284050.1.45028 WP_000284050.1.45043 WP_000284050.1.45053 WP_000284050.1.45068 WP_000284050.1.45076 WP_000284050.1.45104 WP_000284050.1.45116 WP_000284050.1.4515 WP_000284050.1.45153 WP_000284050.1.45156 WP_000284050.1.4516 WP_000284050.1.45190 WP_000284050.1.45195 WP_000284050.1.45208 WP_000284050.1.4524 WP_000284050.1.45246 WP_000284050.1.45293 WP_000284050.1.4530 WP_000284050.1.45301 WP_000284050.1.45313 WP_000284050.1.45329 WP_000284050.1.4535 WP_000284050.1.45359 WP_000284050.1.4538 WP_000284050.1.45392 WP_000284050.1.45404 WP_000284050.1.45405 WP_000284050.1.4541 WP_000284050.1.45440 WP_000284050.1.45444 WP_000284050.1.4549 WP_000284050.1.45494 WP_000284050.1.45500 WP_000284050.1.45525 WP_000284050.1.45536 WP_000284050.1.45538 WP_000284050.1.45565 WP_000284050.1.45581 WP_000284050.1.45600 WP_000284050.1.45627 WP_000284050.1.4563 WP_000284050.1.45664 WP_000284050.1.45674 WP_000284050.1.45676 WP_000284050.1.4570 WP_000284050.1.45707 WP_000284050.1.45718 WP_000284050.1.4574 WP_000284050.1.45740 WP_000284050.1.45741 WP_000284050.1.45752 WP_000284050.1.4576 WP_000284050.1.45789 WP_000284050.1.45793 WP_000284050.1.45799 WP_000284050.1.45801 WP_000284050.1.4583 WP_000284050.1.45840 WP_000284050.1.45841 WP_000284050.1.45846 WP_000284050.1.45865 WP_000284050.1.45868 WP_000284050.1.45891 WP_000284050.1.45901 WP_000284050.1.45921 WP_000284050.1.4593 WP_000284050.1.45930 WP_000284050.1.45931 WP_000284050.1.45933 WP_000284050.1.45941 WP_000284050.1.45945 WP_000284050.1.45949 WP_000284050.1.45960 WP_000284050.1.45962 WP_000284050.1.45968 WP_000284050.1.45990 WP_000284050.1.45991 WP_000284050.1.4600 WP_000284050.1.46016 WP_000284050.1.46026 WP_000284050.1.46027 WP_000284050.1.46039 WP_000284050.1.46048 WP_000284050.1.46049 WP_000284050.1.46070 WP_000284050.1.46081 WP_000284050.1.46097 WP_000284050.1.4610 WP_000284050.1.46105 WP_000284050.1.46115 WP_000284050.1.46122 WP_000284050.1.4613 WP_000284050.1.46164 WP_000284050.1.4617 WP_000284050.1.46186 WP_000284050.1.4619 WP_000284050.1.46197 WP_000284050.1.46213 WP_000284050.1.46217 WP_000284050.1.46239 WP_000284050.1.46245 WP_000284050.1.46257 WP_000284050.1.46263 WP_000284050.1.46282 WP_000284050.1.46283 WP_000284050.1.46291 WP_000284050.1.46301 WP_000284050.1.46325 WP_000284050.1.46329 WP_000284050.1.46369 WP_000284050.1.46378 WP_000284050.1.46379 WP_000284050.1.46414 WP_000284050.1.46429 WP_000284050.1.4643 WP_000284050.1.46433 WP_000284050.1.46438 WP_000284050.1.46441 WP_000284050.1.46451 WP_000284050.1.4646 WP_000284050.1.46468 WP_000284050.1.4647 WP_000284050.1.46477 WP_000284050.1.46487 WP_000284050.1.46503 WP_000284050.1.46526 WP_000284050.1.46531 WP_000284050.1.46541 WP_000284050.1.46552 WP_000284050.1.46555 WP_000284050.1.4657 WP_000284050.1.46573 WP_000284050.1.46582 WP_000284050.1.46589 WP_000284050.1.46594 WP_000284050.1.46597 WP_000284050.1.46602 WP_000284050.1.46611 WP_000284050.1.46614 WP_000284050.1.46616 WP_000284050.1.46626 WP_000284050.1.46643 WP_000284050.1.46655 WP_000284050.1.46668 WP_000284050.1.4670 WP_000284050.1.46734 WP_000284050.1.46743 WP_000284050.1.46795 WP_000284050.1.46798 WP_000284050.1.46802 WP_000284050.1.46806 WP_000284050.1.46810 WP_000284050.1.46820 WP_000284050.1.46821 WP_000284050.1.46832 WP_000284050.1.46833 WP_000284050.1.46841 WP_000284050.1.46857 WP_000284050.1.46860 WP_000284050.1.46876 WP_000284050.1.46882 WP_000284050.1.46898 WP_000284050.1.46909 WP_000284050.1.4691 WP_000284050.1.46912 WP_000284050.1.46913 WP_000284050.1.4695 WP_000284050.1.46990 WP_000284050.1.46994 WP_000284050.1.46999 WP_000284050.1.47024 WP_000284050.1.47028 WP_000284050.1.47029 WP_000284050.1.47030 WP_000284050.1.47034 WP_000284050.1.47038 WP_000284050.1.47039 WP_000284050.1.47047 WP_000284050.1.47048 WP_000284050.1.47050 WP_000284050.1.47054 WP_000284050.1.47063 WP_000284050.1.47069 WP_000284050.1.47073 WP_000284050.1.4708 WP_000284050.1.47124 WP_000284050.1.47135 WP_000284050.1.47140 WP_000284050.1.47156 WP_000284050.1.47167 WP_000284050.1.47171 WP_000284050.1.47186 WP_000284050.1.47189 WP_000284050.1.47197 WP_000284050.1.47198 WP_000284050.1.4722 WP_000284050.1.47224 WP_000284050.1.4723 WP_000284050.1.47235 WP_000284050.1.47246 WP_000284050.1.47247 WP_000284050.1.4725 WP_000284050.1.47280 WP_000284050.1.47307 WP_000284050.1.47316 WP_000284050.1.47319 WP_000284050.1.47322 WP_000284050.1.47332 WP_000284050.1.47349 WP_000284050.1.47350 WP_000284050.1.47356 WP_000284050.1.47363 WP_000284050.1.47366 WP_000284050.1.47370 WP_000284050.1.47386 WP_000284050.1.47398 WP_000284050.1.4740 WP_000284050.1.47401 WP_000284050.1.47411 WP_000284050.1.47414 WP_000284050.1.47416 WP_000284050.1.47425 WP_000284050.1.4743 WP_000284050.1.47451 WP_000284050.1.47454 WP_000284050.1.47464 WP_000284050.1.47477 WP_000284050.1.47488 WP_000284050.1.47496 WP_000284050.1.47498 WP_000284050.1.47529 WP_000284050.1.47546 WP_000284050.1.47555 WP_000284050.1.47582 WP_000284050.1.47599 WP_000284050.1.47634 WP_000284050.1.47647 WP_000284050.1.47654 WP_000284050.1.47662 WP_000284050.1.47673 WP_000284050.1.47709 WP_000284050.1.4772 WP_000284050.1.4773 WP_000284050.1.47734 WP_000284050.1.47744 WP_000284050.1.47761 WP_000284050.1.47764 WP_000284050.1.47765 WP_000284050.1.47770 WP_000284050.1.47775 WP_000284050.1.47784 WP_000284050.1.47790 WP_000284050.1.47791 WP_000284050.1.47820 WP_000284050.1.47827 WP_000284050.1.4783 WP_000284050.1.47837 WP_000284050.1.47848 WP_000284050.1.4785 WP_000284050.1.47884 WP_000284050.1.47914 WP_000284050.1.47935 WP_000284050.1.47954 WP_000284050.1.4796 WP_000284050.1.47962 WP_000284050.1.47976 WP_000284050.1.47981 WP_000284050.1.47983 WP_000284050.1.47994 WP_000284050.1.48000 WP_000284050.1.48018 WP_000284050.1.48029 WP_000284050.1.48040 WP_000284050.1.48048 WP_000284050.1.48051 WP_000284050.1.48065 WP_000284050.1.48073 WP_000284050.1.48077 WP_000284050.1.48080 WP_000284050.1.48087 WP_000284050.1.48090 WP_000284050.1.4811 WP_000284050.1.48111 WP_000284050.1.4812 WP_000284050.1.48121 WP_000284050.1.48144 WP_000284050.1.48168 WP_000284050.1.48176 WP_000284050.1.48188 WP_000284050.1.48194 WP_000284050.1.48200 WP_000284050.1.48216 WP_000284050.1.48222 WP_000284050.1.48226 WP_000284050.1.48229 WP_000284050.1.48258 WP_000284050.1.4826 WP_000284050.1.48265 WP_000284050.1.48285 WP_000284050.1.48290 WP_000284050.1.48291 WP_000284050.1.48317 WP_000284050.1.48353 WP_000284050.1.48355 WP_000284050.1.48371 WP_000284050.1.48385 WP_000284050.1.48404 WP_000284050.1.48417 WP_000284050.1.48421 WP_000284050.1.48431 WP_000284050.1.48433 WP_000284050.1.48469 WP_000284050.1.48477 WP_000284050.1.48480 WP_000284050.1.48483 WP_000284050.1.48505 WP_000284050.1.48522 WP_000284050.1.4857 WP_000284050.1.48571 WP_000284050.1.48590 WP_000284050.1.486 WP_000284050.1.48602 WP_000284050.1.48615 WP_000284050.1.48620 WP_000284050.1.48626 WP_000284050.1.48629 WP_000284050.1.48678 WP_000284050.1.48689 WP_000284050.1.48697 WP_000284050.1.4871 WP_000284050.1.48712 WP_000284050.1.4876 WP_000284050.1.48771 WP_000284050.1.48792 WP_000284050.1.48801 WP_000284050.1.48806 WP_000284050.1.48808 WP_000284050.1.48825 WP_000284050.1.48827 WP_000284050.1.48847 WP_000284050.1.48860 WP_000284050.1.48901 WP_000284050.1.48902 WP_000284050.1.48907 WP_000284050.1.48910 WP_000284050.1.4892 WP_000284050.1.48921 WP_000284050.1.48926 WP_000284050.1.48928 WP_000284050.1.48953 WP_000284050.1.48954 WP_000284050.1.48970 WP_000284050.1.48974 WP_000284050.1.49001 WP_000284050.1.49009 WP_000284050.1.49061 WP_000284050.1.49076 WP_000284050.1.49104 WP_000284050.1.49107 WP_000284050.1.49124 WP_000284050.1.49136 WP_000284050.1.49141 WP_000284050.1.49147 WP_000284050.1.49170 WP_000284050.1.49179 WP_000284050.1.49190 WP_000284050.1.49229 WP_000284050.1.49236 WP_000284050.1.49243 WP_000284050.1.49259 WP_000284050.1.49275 WP_000284050.1.4931 WP_000284050.1.49312 WP_000284050.1.49321 WP_000284050.1.49332 WP_000284050.1.49336 WP_000284050.1.49338 WP_000284050.1.49342 WP_000284050.1.49347 WP_000284050.1.49363 WP_000284050.1.49401 WP_000284050.1.49412 WP_000284050.1.49431 WP_000284050.1.49459 WP_000284050.1.49464 WP_000284050.1.49481 WP_000284050.1.49482 WP_000284050.1.49483 WP_000284050.1.4949 WP_000284050.1.49496 WP_000284050.1.49521 WP_000284050.1.49522 WP_000284050.1.49528 WP_000284050.1.4953 WP_000284050.1.49531 WP_000284050.1.49537 WP_000284050.1.49546 WP_000284050.1.49558 WP_000284050.1.49567 WP_000284050.1.49594 WP_000284050.1.49599 WP_000284050.1.49615 WP_000284050.1.49621 WP_000284050.1.49625 WP_000284050.1.49655 WP_000284050.1.49661 WP_000284050.1.49662 WP_000284050.1.49675 WP_000284050.1.49684 WP_000284050.1.497 WP_000284050.1.49712 WP_000284050.1.49722 WP_000284050.1.49733 WP_000284050.1.49740 WP_000284050.1.49747 WP_000284050.1.49768 WP_000284050.1.49771 WP_000284050.1.49774 WP_000284050.1.49777 WP_000284050.1.49783 WP_000284050.1.49794 WP_000284050.1.49820 WP_000284050.1.49823 WP_000284050.1.4985 WP_000284050.1.49856 WP_000284050.1.49861 WP_000284050.1.49879 WP_000284050.1.49883 WP_000284050.1.49884 WP_000284050.1.49900 WP_000284050.1.49902 WP_000284050.1.49941 WP_000284050.1.49950 WP_000284050.1.49954 WP_000284050.1.49972 WP_000284050.1.49987 WP_000284050.1.50006 WP_000284050.1.50008 WP_000284050.1.5003 WP_000284050.1.50036 WP_000284050.1.50056 WP_000284050.1.50058 WP_000284050.1.50078 WP_000284050.1.50098 WP_000284050.1.50110 WP_000284050.1.50113 WP_000284050.1.50119 WP_000284050.1.50136 WP_000284050.1.50146 WP_000284050.1.5017 WP_000284050.1.50179 WP_000284050.1.50182 WP_000284050.1.50187 WP_000284050.1.50191 WP_000284050.1.50196 WP_000284050.1.50207 WP_000284050.1.50214 WP_000284050.1.50228 WP_000284050.1.50230 WP_000284050.1.50258 WP_000284050.1.50262 WP_000284050.1.50266 WP_000284050.1.50269 WP_000284050.1.50270 WP_000284050.1.50273 WP_000284050.1.50278 WP_000284050.1.50329 WP_000284050.1.50345 WP_000284050.1.50353 WP_000284050.1.50358 WP_000284050.1.50361 WP_000284050.1.50366 WP_000284050.1.5037 WP_000284050.1.50380 WP_000284050.1.50381 WP_000284050.1.5040 WP_000284050.1.5041 WP_000284050.1.50412 WP_000284050.1.50418 WP_000284050.1.50427 WP_000284050.1.50446 WP_000284050.1.50452 WP_000284050.1.5046 WP_000284050.1.50539 WP_000284050.1.50548 WP_000284050.1.50549 WP_000284050.1.5056 WP_000284050.1.50564 WP_000284050.1.50585 WP_000284050.1.50586 WP_000284050.1.506 WP_000284050.1.50608 WP_000284050.1.5061 WP_000284050.1.50616 WP_000284050.1.50627 WP_000284050.1.5064 WP_000284050.1.5067 WP_000284050.1.50690 WP_000284050.1.50700 WP_000284050.1.50715 WP_000284050.1.50717 WP_000284050.1.50725 WP_000284050.1.50728 WP_000284050.1.50762 WP_000284050.1.50887 WP_000284050.1.50925 WP_000284050.1.50936 WP_000284050.1.50939 WP_000284050.1.50947 WP_000284050.1.5095 WP_000284050.1.50969 WP_000284050.1.50986 WP_000284050.1.50988 WP_000284050.1.50990 WP_000284050.1.50993 WP_000284050.1.50996 WP_000284050.1.51013 WP_000284050.1.51027 WP_000284050.1.51042 WP_000284050.1.51058 WP_000284050.1.5106 WP_000284050.1.511 WP_000284050.1.51127 WP_000284050.1.51154 WP_000284050.1.51170 WP_000284050.1.51171 WP_000284050.1.51172 WP_000284050.1.51175 WP_000284050.1.51180 WP_000284050.1.51190 WP_000284050.1.51201 WP_000284050.1.51203 WP_000284050.1.51206 WP_000284050.1.51211 WP_000284050.1.5124 WP_000284050.1.51248 WP_000284050.1.51253 WP_000284050.1.51255 WP_000284050.1.51260 WP_000284050.1.51278 WP_000284050.1.5128 WP_000284050.1.51299 WP_000284050.1.51300 WP_000284050.1.51307 WP_000284050.1.51320 WP_000284050.1.51323 WP_000284050.1.51325 WP_000284050.1.51330 WP_000284050.1.51336 WP_000284050.1.51354 WP_000284050.1.51360 WP_000284050.1.51364 WP_000284050.1.51380 WP_000284050.1.51392 WP_000284050.1.51405 WP_000284050.1.51426 WP_000284050.1.51427 WP_000284050.1.51430 WP_000284050.1.51441 WP_000284050.1.5146 WP_000284050.1.51462 WP_000284050.1.51482 WP_000284050.1.51490 WP_000284050.1.51495 WP_000284050.1.51503 WP_000284050.1.51505 WP_000284050.1.51513 WP_000284050.1.51525 WP_000284050.1.5153 WP_000284050.1.51537 WP_000284050.1.51539 WP_000284050.1.51542 WP_000284050.1.51548 WP_000284050.1.51552 WP_000284050.1.5157 WP_000284050.1.51580 WP_000284050.1.51587 WP_000284050.1.51596 WP_000284050.1.51600 WP_000284050.1.51607 WP_000284050.1.51624 WP_000284050.1.51629 WP_000284050.1.51643 WP_000284050.1.51662 WP_000284050.1.51690 WP_000284050.1.51693 WP_000284050.1.51707 WP_000284050.1.51718 WP_000284050.1.5172 WP_000284050.1.51736 WP_000284050.1.51757 WP_000284050.1.51760 WP_000284050.1.51784 WP_000284050.1.518 WP_000284050.1.51804 WP_000284050.1.51834 WP_000284050.1.51837 WP_000284050.1.51839 WP_000284050.1.51869 WP_000284050.1.51873 WP_000284050.1.51896 WP_000284050.1.51899 WP_000284050.1.51906 WP_000284050.1.51944 WP_000284050.1.51949 WP_000284050.1.51968 WP_000284050.1.51979 WP_000284050.1.51985 WP_000284050.1.51988 WP_000284050.1.5199 WP_000284050.1.51999 WP_000284050.1.52002 WP_000284050.1.52011 WP_000284050.1.52020 WP_000284050.1.52039 WP_000284050.1.52044 WP_000284050.1.52048 WP_000284050.1.52062 WP_000284050.1.52076 WP_000284050.1.52085 WP_000284050.1.52098 WP_000284050.1.52111 WP_000284050.1.52126 WP_000284050.1.52127 WP_000284050.1.52135 WP_000284050.1.5217 WP_000284050.1.52171 WP_000284050.1.52186 WP_000284050.1.52200 WP_000284050.1.52211 WP_000284050.1.52213 WP_000284050.1.52214 WP_000284050.1.52225 WP_000284050.1.52230 WP_000284050.1.52236 WP_000284050.1.52240 WP_000284050.1.52243 WP_000284050.1.52249 WP_000284050.1.52257 WP_000284050.1.52258 WP_000284050.1.5227 WP_000284050.1.52270 WP_000284050.1.52271 WP_000284050.1.52272 WP_000284050.1.52299 WP_000284050.1.52304 WP_000284050.1.52305 WP_000284050.1.52313 WP_000284050.1.52324 WP_000284050.1.52328 WP_000284050.1.52333 WP_000284050.1.52363 WP_000284050.1.52378 WP_000284050.1.5239 WP_000284050.1.52399 WP_000284050.1.52406 WP_000284050.1.52413 WP_000284050.1.52419 WP_000284050.1.52421 WP_000284050.1.52492 WP_000284050.1.52496 WP_000284050.1.52524 WP_000284050.1.52542 WP_000284050.1.52543 WP_000284050.1.52554 WP_000284050.1.52558 WP_000284050.1.52567 WP_000284050.1.52568 WP_000284050.1.52601 WP_000284050.1.52631 WP_000284050.1.5265 WP_000284050.1.52662 WP_000284050.1.52691 WP_000284050.1.52704 WP_000284050.1.52710 WP_000284050.1.5272 WP_000284050.1.52735 WP_000284050.1.52755 WP_000284050.1.52762 WP_000284050.1.52771 WP_000284050.1.52774 WP_000284050.1.52777 WP_000284050.1.52780 WP_000284050.1.52781 WP_000284050.1.52801 WP_000284050.1.52844 WP_000284050.1.52846 WP_000284050.1.5285 WP_000284050.1.52852 WP_000284050.1.52853 WP_000284050.1.52855 WP_000284050.1.52881 WP_000284050.1.52883 WP_000284050.1.52895 WP_000284050.1.52908 WP_000284050.1.5291 WP_000284050.1.52913 WP_000284050.1.52933 WP_000284050.1.52942 WP_000284050.1.52945 WP_000284050.1.52962 WP_000284050.1.52995 WP_000284050.1.52996 WP_000284050.1.53012 WP_000284050.1.53020 WP_000284050.1.53021 WP_000284050.1.53027 WP_000284050.1.53065 WP_000284050.1.53084 WP_000284050.1.53095 WP_000284050.1.53099 WP_000284050.1.5310 WP_000284050.1.53110 WP_000284050.1.53123 WP_000284050.1.53155 WP_000284050.1.53162 WP_000284050.1.53181 WP_000284050.1.53186 WP_000284050.1.532 WP_000284050.1.53211 WP_000284050.1.5322 WP_000284050.1.53223 WP_000284050.1.53228 WP_000284050.1.53238 WP_000284050.1.53242 WP_000284050.1.53244 WP_000284050.1.53251 WP_000284050.1.53252 WP_000284050.1.53262 WP_000284050.1.53270 WP_000284050.1.53277 WP_000284050.1.53308 WP_000284050.1.53327 WP_000284050.1.53356 WP_000284050.1.53360 WP_000284050.1.53364 WP_000284050.1.53377 WP_000284050.1.53401 WP_000284050.1.53410 WP_000284050.1.53415 WP_000284050.1.53419 WP_000284050.1.5342 WP_000284050.1.53428 WP_000284050.1.53431 WP_000284050.1.53482 WP_000284050.1.53505 WP_000284050.1.5351 WP_000284050.1.53535 WP_000284050.1.53537 WP_000284050.1.53545 WP_000284050.1.53557 WP_000284050.1.53574 WP_000284050.1.53582 WP_000284050.1.53587 WP_000284050.1.53589 WP_000284050.1.53590 WP_000284050.1.53592 WP_000284050.1.53594 WP_000284050.1.5362 WP_000284050.1.53642 WP_000284050.1.53645 WP_000284050.1.53649 WP_000284050.1.53687 WP_000284050.1.53690 WP_000284050.1.53706 WP_000284050.1.53769 WP_000284050.1.53809 WP_000284050.1.53810 WP_000284050.1.53811 WP_000284050.1.53841 WP_000284050.1.53863 WP_000284050.1.53866 WP_000284050.1.53878 WP_000284050.1.53884 WP_000284050.1.5391 WP_000284050.1.5393 WP_000284050.1.53931 WP_000284050.1.53940 WP_000284050.1.5395 WP_000284050.1.53966 WP_000284050.1.53968 WP_000284050.1.53972 WP_000284050.1.53978 WP_000284050.1.53991 WP_000284050.1.53994 WP_000284050.1.54002 WP_000284050.1.54013 WP_000284050.1.54023 WP_000284050.1.54024 WP_000284050.1.54028 WP_000284050.1.54032 WP_000284050.1.54051 WP_000284050.1.54072 WP_000284050.1.54091 WP_000284050.1.54095 WP_000284050.1.54102 WP_000284050.1.54144 WP_000284050.1.54169 WP_000284050.1.54185 WP_000284050.1.54188 WP_000284050.1.54202 WP_000284050.1.54208 WP_000284050.1.54213 WP_000284050.1.54263 WP_000284050.1.54307 WP_000284050.1.54313 WP_000284050.1.54328 WP_000284050.1.54329 WP_000284050.1.5433 WP_000284050.1.5434 WP_000284050.1.54344 WP_000284050.1.54359 WP_000284050.1.54388 WP_000284050.1.54394 WP_000284050.1.5440 WP_000284050.1.5441 WP_000284050.1.54411 WP_000284050.1.54417 WP_000284050.1.54418 WP_000284050.1.54429 WP_000284050.1.54439 WP_000284050.1.54454 WP_000284050.1.54463 WP_000284050.1.54476 WP_000284050.1.54507 WP_000284050.1.54524 WP_000284050.1.54534 WP_000284050.1.54546 WP_000284050.1.54585 WP_000284050.1.54590 WP_000284050.1.54591 WP_000284050.1.5460 WP_000284050.1.54601 WP_000284050.1.54602 WP_000284050.1.54605 WP_000284050.1.54614 WP_000284050.1.54617 WP_000284050.1.54620 WP_000284050.1.54625 WP_000284050.1.54638 WP_000284050.1.54641 WP_000284050.1.54643 WP_000284050.1.5467 WP_000284050.1.54695 WP_000284050.1.5470 WP_000284050.1.54708 WP_000284050.1.54725 WP_000284050.1.54729 WP_000284050.1.54754 WP_000284050.1.54755 WP_000284050.1.54760 WP_000284050.1.54769 WP_000284050.1.5478 WP_000284050.1.5479 WP_000284050.1.54798 WP_000284050.1.54817 WP_000284050.1.54829 WP_000284050.1.5486 WP_000284050.1.54875 WP_000284050.1.54883 WP_000284050.1.54918 WP_000284050.1.54921 WP_000284050.1.54927 WP_000284050.1.54940 WP_000284050.1.54941 WP_000284050.1.54946 WP_000284050.1.54972 WP_000284050.1.54981 WP_000284050.1.54989 WP_000284050.1.54991 WP_000284050.1.54993 WP_000284050.1.55003 WP_000284050.1.55005 WP_000284050.1.55009 WP_000284050.1.55041 WP_000284050.1.55070 WP_000284050.1.55112 WP_000284050.1.55115 WP_000284050.1.55123 WP_000284050.1.55134 WP_000284050.1.55144 WP_000284050.1.55149 WP_000284050.1.55151 WP_000284050.1.55177 WP_000284050.1.55179 WP_000284050.1.55185 WP_000284050.1.55197 WP_000284050.1.5520 WP_000284050.1.55203 WP_000284050.1.55218 WP_000284050.1.55222 WP_000284050.1.55226 WP_000284050.1.55273 WP_000284050.1.55275 WP_000284050.1.55286 WP_000284050.1.55291 WP_000284050.1.55338 WP_000284050.1.55342 WP_000284050.1.55357 WP_000284050.1.55359 WP_000284050.1.55374 WP_000284050.1.55417 WP_000284050.1.55420 WP_000284050.1.55424 WP_000284050.1.55425 WP_000284050.1.5546 WP_000284050.1.55466 WP_000284050.1.55482 WP_000284050.1.55483 WP_000284050.1.55489 WP_000284050.1.55492 WP_000284050.1.55507 WP_000284050.1.55529 WP_000284050.1.55550 WP_000284050.1.55551 WP_000284050.1.55552 WP_000284050.1.55556 WP_000284050.1.55560 WP_000284050.1.55563 WP_000284050.1.55571 WP_000284050.1.55574 WP_000284050.1.55581 WP_000284050.1.55597 WP_000284050.1.55608 WP_000284050.1.5561 WP_000284050.1.55629 WP_000284050.1.5566 WP_000284050.1.55676 WP_000284050.1.5570 WP_000284050.1.55709 WP_000284050.1.55720 WP_000284050.1.55727 WP_000284050.1.55730 WP_000284050.1.55731 WP_000284050.1.55757 WP_000284050.1.55787 WP_000284050.1.55790 WP_000284050.1.55791 WP_000284050.1.55808 WP_000284050.1.55820 WP_000284050.1.55825 WP_000284050.1.55838 WP_000284050.1.55844 WP_000284050.1.55868 WP_000284050.1.55870 WP_000284050.1.55888 WP_000284050.1.55892 WP_000284050.1.55896 WP_000284050.1.55897 WP_000284050.1.55936 WP_000284050.1.55979 WP_000284050.1.55981 WP_000284050.1.55988 WP_000284050.1.55990 WP_000284050.1.56033 WP_000284050.1.56040 WP_000284050.1.56047 WP_000284050.1.56072 WP_000284050.1.561 WP_000284050.1.56101 WP_000284050.1.56122 WP_000284050.1.56139 WP_000284050.1.5614 WP_000284050.1.56142 WP_000284050.1.56149 WP_000284050.1.56151 WP_000284050.1.5616 WP_000284050.1.56164 WP_000284050.1.56169 WP_000284050.1.56177 WP_000284050.1.56193 WP_000284050.1.56197 WP_000284050.1.56216 WP_000284050.1.56278 WP_000284050.1.56285 WP_000284050.1.56293 WP_000284050.1.56302 WP_000284050.1.5632 WP_000284050.1.56338 WP_000284050.1.56345 WP_000284050.1.56358 WP_000284050.1.56371 WP_000284050.1.56388 WP_000284050.1.5639 WP_000284050.1.56390 WP_000284050.1.56392 WP_000284050.1.56399 WP_000284050.1.56402 WP_000284050.1.56436 WP_000284050.1.56439 WP_000284050.1.56446 WP_000284050.1.56457 WP_000284050.1.5646 WP_000284050.1.56469 WP_000284050.1.56481 WP_000284050.1.56489 WP_000284050.1.5649 WP_000284050.1.56491 WP_000284050.1.56501 WP_000284050.1.56513 WP_000284050.1.56523 WP_000284050.1.56528 WP_000284050.1.56543 WP_000284050.1.56554 WP_000284050.1.56571 WP_000284050.1.56573 WP_000284050.1.56586 WP_000284050.1.56650 WP_000284050.1.56662 WP_000284050.1.56665 WP_000284050.1.56680 WP_000284050.1.56689 WP_000284050.1.5670 WP_000284050.1.56704 WP_000284050.1.56713 WP_000284050.1.56714 WP_000284050.1.56721 WP_000284050.1.56742 WP_000284050.1.56776 WP_000284050.1.56777 WP_000284050.1.56786 WP_000284050.1.56787 WP_000284050.1.56789 WP_000284050.1.56799 WP_000284050.1.56821 WP_000284050.1.56835 WP_000284050.1.56846 WP_000284050.1.5685 WP_000284050.1.56871 WP_000284050.1.56882 WP_000284050.1.56908 WP_000284050.1.56932 WP_000284050.1.56933 WP_000284050.1.56934 WP_000284050.1.56936 WP_000284050.1.56937 WP_000284050.1.56941 WP_000284050.1.56951 WP_000284050.1.56978 WP_000284050.1.56980 WP_000284050.1.56992 WP_000284050.1.57011 WP_000284050.1.57032 WP_000284050.1.57045 WP_000284050.1.57051 WP_000284050.1.57068 WP_000284050.1.57071 WP_000284050.1.57072 WP_000284050.1.57079 WP_000284050.1.57086 WP_000284050.1.57100 WP_000284050.1.57124 WP_000284050.1.57150 WP_000284050.1.57159 WP_000284050.1.57180 WP_000284050.1.57181 WP_000284050.1.57182 WP_000284050.1.57185 WP_000284050.1.57197 WP_000284050.1.57202 WP_000284050.1.57213 WP_000284050.1.57216 WP_000284050.1.57222 WP_000284050.1.57254 WP_000284050.1.57269 WP_000284050.1.57278 WP_000284050.1.57280 WP_000284050.1.57281 WP_000284050.1.57319 WP_000284050.1.57348 WP_000284050.1.57349 WP_000284050.1.57386 WP_000284050.1.57395 WP_000284050.1.57403 WP_000284050.1.57410 WP_000284050.1.57414 WP_000284050.1.5742 WP_000284050.1.57432 WP_000284050.1.57438 WP_000284050.1.57451 WP_000284050.1.57453 WP_000284050.1.57466 WP_000284050.1.5748 WP_000284050.1.57487 WP_000284050.1.57517 WP_000284050.1.57538 WP_000284050.1.57539 WP_000284050.1.5755 WP_000284050.1.57558 WP_000284050.1.57574 WP_000284050.1.57588 WP_000284050.1.57608 WP_000284050.1.57610 WP_000284050.1.57628 WP_000284050.1.57629 WP_000284050.1.57634 WP_000284050.1.57638 WP_000284050.1.5764 WP_000284050.1.57646 WP_000284050.1.57659 WP_000284050.1.57663 WP_000284050.1.57669 WP_000284050.1.57719 WP_000284050.1.57738 WP_000284050.1.57812 WP_000284050.1.57832 WP_000284050.1.57836 WP_000284050.1.57846 WP_000284050.1.57851 WP_000284050.1.57854 WP_000284050.1.5787 WP_000284050.1.57898 WP_000284050.1.57903 WP_000284050.1.57904 WP_000284050.1.57920 WP_000284050.1.57951 WP_000284050.1.57975 WP_000284050.1.57982 WP_000284050.1.57983 WP_000284050.1.57994 WP_000284050.1.58001 WP_000284050.1.58009 WP_000284050.1.58038 WP_000284050.1.58045 WP_000284050.1.58048 WP_000284050.1.58057 WP_000284050.1.58060 WP_000284050.1.58080 WP_000284050.1.58092 WP_000284050.1.58094 WP_000284050.1.58097 WP_000284050.1.58098 WP_000284050.1.5810 WP_000284050.1.58107 WP_000284050.1.58128 WP_000284050.1.58136 WP_000284050.1.58143 WP_000284050.1.58146 WP_000284050.1.58163 WP_000284050.1.58169 WP_000284050.1.58172 WP_000284050.1.58206 WP_000284050.1.58226 WP_000284050.1.58232 WP_000284050.1.58233 WP_000284050.1.58238 WP_000284050.1.58248 WP_000284050.1.58267 WP_000284050.1.58289 WP_000284050.1.58292 WP_000284050.1.58316 WP_000284050.1.58336 WP_000284050.1.58340 WP_000284050.1.58345 WP_000284050.1.58368 WP_000284050.1.58371 WP_000284050.1.58384 WP_000284050.1.584 WP_000284050.1.58401 WP_000284050.1.58408 WP_000284050.1.58414 WP_000284050.1.5842 WP_000284050.1.58420 WP_000284050.1.58423 WP_000284050.1.58424 WP_000284050.1.58440 WP_000284050.1.58445 WP_000284050.1.58449 WP_000284050.1.58459 WP_000284050.1.58475 WP_000284050.1.58484 WP_000284050.1.58493 WP_000284050.1.58496 WP_000284050.1.585 WP_000284050.1.58507 WP_000284050.1.58514 WP_000284050.1.5852 WP_000284050.1.58528 WP_000284050.1.58547 WP_000284050.1.58552 WP_000284050.1.58560 WP_000284050.1.58572 WP_000284050.1.58582 WP_000284050.1.58609 WP_000284050.1.58617 WP_000284050.1.58622 WP_000284050.1.58657 WP_000284050.1.58680 WP_000284050.1.58705 WP_000284050.1.58707 WP_000284050.1.58723 WP_000284050.1.58737 WP_000284050.1.58799 WP_000284050.1.58837 WP_000284050.1.58867 WP_000284050.1.58870 WP_000284050.1.58901 WP_000284050.1.58940 WP_000284050.1.58942 WP_000284050.1.58951 WP_000284050.1.58958 WP_000284050.1.58976 WP_000284050.1.58977 WP_000284050.1.58983 WP_000284050.1.58999 WP_000284050.1.59024 WP_000284050.1.59026 WP_000284050.1.59035 WP_000284050.1.59038 WP_000284050.1.59047 WP_000284050.1.5906 WP_000284050.1.59060 WP_000284050.1.59073 WP_000284050.1.59083 WP_000284050.1.59119 WP_000284050.1.59165 WP_000284050.1.59174 WP_000284050.1.59190 WP_000284050.1.59199 WP_000284050.1.59218 WP_000284050.1.59226 WP_000284050.1.59263 WP_000284050.1.5927 WP_000284050.1.59280 WP_000284050.1.59291 WP_000284050.1.59292 WP_000284050.1.59293 WP_000284050.1.59302 WP_000284050.1.59306 WP_000284050.1.59359 WP_000284050.1.59374 WP_000284050.1.59395 WP_000284050.1.59396 WP_000284050.1.59407 WP_000284050.1.59409 WP_000284050.1.59413 WP_000284050.1.5942 WP_000284050.1.59423 WP_000284050.1.59425 WP_000284050.1.59426 WP_000284050.1.59434 WP_000284050.1.59470 WP_000284050.1.59483 WP_000284050.1.59491 WP_000284050.1.59513 WP_000284050.1.59553 WP_000284050.1.59572 WP_000284050.1.59579 WP_000284050.1.59590 WP_000284050.1.59613 WP_000284050.1.59615 WP_000284050.1.59621 WP_000284050.1.5963 WP_000284050.1.59638 WP_000284050.1.5965 WP_000284050.1.59660 WP_000284050.1.59679 WP_000284050.1.59689 WP_000284050.1.59699 WP_000284050.1.597 WP_000284050.1.59714 WP_000284050.1.59717 WP_000284050.1.59730 WP_000284050.1.59733 WP_000284050.1.59737 WP_000284050.1.59745 WP_000284050.1.59748 WP_000284050.1.59756 WP_000284050.1.59781 WP_000284050.1.59782 WP_000284050.1.59788 WP_000284050.1.59791 WP_000284050.1.59793 WP_000284050.1.59815 WP_000284050.1.59823 WP_000284050.1.59836 WP_000284050.1.59838 WP_000284050.1.59853 WP_000284050.1.59855 WP_000284050.1.59858 WP_000284050.1.59877 WP_000284050.1.59894 WP_000284050.1.5990 WP_000284050.1.59900 WP_000284050.1.59912 WP_000284050.1.59914 WP_000284050.1.59931 WP_000284050.1.59932 WP_000284050.1.59959 WP_000284050.1.59970 WP_000284050.1.59981 WP_000284050.1.59989 WP_000284050.1.59998 WP_000284050.1.60005 WP_000284050.1.6002 WP_000284050.1.60023 WP_000284050.1.60031 WP_000284050.1.60042 WP_000284050.1.60043 WP_000284050.1.60048 WP_000284050.1.60067 WP_000284050.1.60070 WP_000284050.1.60095 WP_000284050.1.60096 WP_000284050.1.60117 WP_000284050.1.6013 WP_000284050.1.60133 WP_000284050.1.60151 WP_000284050.1.60186 WP_000284050.1.6022 WP_000284050.1.60225 WP_000284050.1.60228 WP_000284050.1.60235 WP_000284050.1.60246 WP_000284050.1.60304 WP_000284050.1.60325 WP_000284050.1.60337 WP_000284050.1.60342 WP_000284050.1.60343 WP_000284050.1.60350 WP_000284050.1.60373 WP_000284050.1.60374 WP_000284050.1.60387 WP_000284050.1.60436 WP_000284050.1.60443 WP_000284050.1.60453 WP_000284050.1.60457 WP_000284050.1.60461 WP_000284050.1.60477 WP_000284050.1.60491 WP_000284050.1.60498 WP_000284050.1.60505 WP_000284050.1.60544 WP_000284050.1.60550 WP_000284050.1.60555 WP_000284050.1.60559 WP_000284050.1.60567 WP_000284050.1.60570 WP_000284050.1.60576 WP_000284050.1.6059 WP_000284050.1.60591 WP_000284050.1.60599 WP_000284050.1.60606 WP_000284050.1.6061 WP_000284050.1.60613 WP_000284050.1.60614 WP_000284050.1.60630 WP_000284050.1.6064 WP_000284050.1.60644 WP_000284050.1.60647 WP_000284050.1.60654 WP_000284050.1.6066 WP_000284050.1.60671 WP_000284050.1.6068 WP_000284050.1.60684 WP_000284050.1.60698 WP_000284050.1.60732 WP_000284050.1.60744 WP_000284050.1.60761 WP_000284050.1.60771 WP_000284050.1.60784 WP_000284050.1.60805 WP_000284050.1.60816 WP_000284050.1.60826 WP_000284050.1.60832 WP_000284050.1.60835 WP_000284050.1.60847 WP_000284050.1.60872 WP_000284050.1.60895 WP_000284050.1.60901 WP_000284050.1.60921 WP_000284050.1.60925 WP_000284050.1.60927 WP_000284050.1.60935 WP_000284050.1.6094 WP_000284050.1.60974 WP_000284050.1.61005 WP_000284050.1.61006 WP_000284050.1.61008 WP_000284050.1.61035 WP_000284050.1.61039 WP_000284050.1.61046 WP_000284050.1.61058 WP_000284050.1.61096 WP_000284050.1.61097 WP_000284050.1.61099 WP_000284050.1.6110 WP_000284050.1.61102 WP_000284050.1.61108 WP_000284050.1.61112 WP_000284050.1.61121 WP_000284050.1.61132 WP_000284050.1.61148 WP_000284050.1.61170 WP_000284050.1.61174 WP_000284050.1.61175 WP_000284050.1.61181 WP_000284050.1.61183 WP_000284050.1.61186 WP_000284050.1.61223 WP_000284050.1.61225 WP_000284050.1.61241 WP_000284050.1.61245 WP_000284050.1.61253 WP_000284050.1.61268 WP_000284050.1.61284 WP_000284050.1.61292 WP_000284050.1.613 WP_000284050.1.61360 WP_000284050.1.61362 WP_000284050.1.61364 WP_000284050.1.61373 WP_000284050.1.6138 WP_000284050.1.61398 WP_000284050.1.61442 WP_000284050.1.61445 WP_000284050.1.61480 WP_000284050.1.61496 WP_000284050.1.615 WP_000284050.1.61512 WP_000284050.1.61517 WP_000284050.1.61524 WP_000284050.1.61551 WP_000284050.1.61608 WP_000284050.1.61612 WP_000284050.1.61617 WP_000284050.1.61623 WP_000284050.1.61636 WP_000284050.1.61643 WP_000284050.1.61663 WP_000284050.1.61703 WP_000284050.1.61718 WP_000284050.1.61739 WP_000284050.1.61758 WP_000284050.1.61770 WP_000284050.1.61772 WP_000284050.1.61779 WP_000284050.1.61789 WP_000284050.1.618 WP_000284050.1.61806 WP_000284050.1.61835 WP_000284050.1.61853 WP_000284050.1.61858 WP_000284050.1.61874 WP_000284050.1.61926 WP_000284050.1.61939 WP_000284050.1.61948 WP_000284050.1.61949 WP_000284050.1.61955 WP_000284050.1.61957 WP_000284050.1.61966 WP_000284050.1.61985 WP_000284050.1.62015 WP_000284050.1.62038 WP_000284050.1.62041 WP_000284050.1.62043 WP_000284050.1.62091 WP_000284050.1.62099 WP_000284050.1.62102 WP_000284050.1.6212 WP_000284050.1.62135 WP_000284050.1.62157 WP_000284050.1.62182 WP_000284050.1.62207 WP_000284050.1.62236 WP_000284050.1.62262 WP_000284050.1.62264 WP_000284050.1.62266 WP_000284050.1.62273 WP_000284050.1.62290 WP_000284050.1.62296 WP_000284050.1.62303 WP_000284050.1.62337 WP_000284050.1.62348 WP_000284050.1.62358 WP_000284050.1.62424 WP_000284050.1.62447 WP_000284050.1.6245 WP_000284050.1.62454 WP_000284050.1.62460 WP_000284050.1.62480 WP_000284050.1.62503 WP_000284050.1.62507 WP_000284050.1.62513 WP_000284050.1.62514 WP_000284050.1.62529 WP_000284050.1.62541 WP_000284050.1.62555 WP_000284050.1.62586 WP_000284050.1.6261 WP_000284050.1.62612 WP_000284050.1.62631 WP_000284050.1.62642 WP_000284050.1.62668 WP_000284050.1.62675 WP_000284050.1.62681 WP_000284050.1.62714 WP_000284050.1.62735 WP_000284050.1.62750 WP_000284050.1.62762 WP_000284050.1.62769 WP_000284050.1.62780 WP_000284050.1.62784 WP_000284050.1.62787 WP_000284050.1.62788 WP_000284050.1.62802 WP_000284050.1.62812 WP_000284050.1.62818 WP_000284050.1.62819 WP_000284050.1.6282 WP_000284050.1.62840 WP_000284050.1.62843 WP_000284050.1.62850 WP_000284050.1.62851 WP_000284050.1.62866 WP_000284050.1.62885 WP_000284050.1.62888 WP_000284050.1.62914 WP_000284050.1.62919 WP_000284050.1.6293 WP_000284050.1.62931 WP_000284050.1.62951 WP_000284050.1.62959 WP_000284050.1.62989 WP_000284050.1.6299 WP_000284050.1.62992 WP_000284050.1.63023 WP_000284050.1.6307 WP_000284050.1.63078 WP_000284050.1.63167 WP_000284050.1.63177 WP_000284050.1.63189 WP_000284050.1.6323 WP_000284050.1.63246 WP_000284050.1.63271 WP_000284050.1.63285 WP_000284050.1.63287 WP_000284050.1.63305 WP_000284050.1.6331 WP_000284050.1.63310 WP_000284050.1.6334 WP_000284050.1.63350 WP_000284050.1.63370 WP_000284050.1.63374 WP_000284050.1.63393 WP_000284050.1.63419 WP_000284050.1.63433 WP_000284050.1.63435 WP_000284050.1.63437 WP_000284050.1.63444 WP_000284050.1.63445 WP_000284050.1.63453 WP_000284050.1.63465 WP_000284050.1.63466 WP_000284050.1.63467 WP_000284050.1.63470 WP_000284050.1.63478 WP_000284050.1.6348 WP_000284050.1.63484 WP_000284050.1.63487 WP_000284050.1.63491 WP_000284050.1.63496 WP_000284050.1.63536 WP_000284050.1.63554 WP_000284050.1.63556 WP_000284050.1.63563 WP_000284050.1.63576 WP_000284050.1.63586 WP_000284050.1.63602 WP_000284050.1.63604 WP_000284050.1.63608 WP_000284050.1.63612 WP_000284050.1.63615 WP_000284050.1.6364 WP_000284050.1.63666 WP_000284050.1.63679 WP_000284050.1.63683 WP_000284050.1.63703 WP_000284050.1.63721 WP_000284050.1.63746 WP_000284050.1.63800 WP_000284050.1.63810 WP_000284050.1.63814 WP_000284050.1.63821 WP_000284050.1.63856 WP_000284050.1.63871 WP_000284050.1.63872 WP_000284050.1.63957 WP_000284050.1.63964 WP_000284050.1.63969 WP_000284050.1.63990 WP_000284050.1.64008 WP_000284050.1.64014 WP_000284050.1.64030 WP_000284050.1.64040 WP_000284050.1.64045 WP_000284050.1.64050 WP_000284050.1.64053 WP_000284050.1.64074 WP_000284050.1.64080 WP_000284050.1.64086 WP_000284050.1.64110 WP_000284050.1.64150 WP_000284050.1.64153 WP_000284050.1.6416 WP_000284050.1.64161 WP_000284050.1.64165 WP_000284050.1.64175 WP_000284050.1.64180 WP_000284050.1.64190 WP_000284050.1.64193 WP_000284050.1.64280 WP_000284050.1.64285 WP_000284050.1.64286 WP_000284050.1.643 WP_000284050.1.6431 WP_000284050.1.64312 WP_000284050.1.64321 WP_000284050.1.64330 WP_000284050.1.64337 WP_000284050.1.64353 WP_000284050.1.64355 WP_000284050.1.64356 WP_000284050.1.64371 WP_000284050.1.64380 WP_000284050.1.6441 WP_000284050.1.64417 WP_000284050.1.64437 WP_000284050.1.64438 WP_000284050.1.6444 WP_000284050.1.6445 WP_000284050.1.64458 WP_000284050.1.6446 WP_000284050.1.64519 WP_000284050.1.64520 WP_000284050.1.64540 WP_000284050.1.64547 WP_000284050.1.64563 WP_000284050.1.64621 WP_000284050.1.64634 WP_000284050.1.64657 WP_000284050.1.64670 WP_000284050.1.6469 WP_000284050.1.64693 WP_000284050.1.64695 WP_000284050.1.647 WP_000284050.1.64707 WP_000284050.1.64712 WP_000284050.1.64746 WP_000284050.1.64749 WP_000284050.1.64784 WP_000284050.1.64793 WP_000284050.1.64821 WP_000284050.1.64840 WP_000284050.1.64866 WP_000284050.1.64875 WP_000284050.1.64881 WP_000284050.1.64895 WP_000284050.1.64912 WP_000284050.1.64926 WP_000284050.1.64930 WP_000284050.1.64939 WP_000284050.1.64946 WP_000284050.1.64970 WP_000284050.1.6499 WP_000284050.1.64990 WP_000284050.1.6500 WP_000284050.1.65023 WP_000284050.1.65035 WP_000284050.1.65040 WP_000284050.1.65056 WP_000284050.1.65061 WP_000284050.1.65084 WP_000284050.1.65097 WP_000284050.1.651 WP_000284050.1.65104 WP_000284050.1.6511 WP_000284050.1.65110 WP_000284050.1.65114 WP_000284050.1.65116 WP_000284050.1.65118 WP_000284050.1.65122 WP_000284050.1.65135 WP_000284050.1.65151 WP_000284050.1.65155 WP_000284050.1.6516 WP_000284050.1.65179 WP_000284050.1.65192 WP_000284050.1.65194 WP_000284050.1.65206 WP_000284050.1.65240 WP_000284050.1.65256 WP_000284050.1.6527 WP_000284050.1.65271 WP_000284050.1.65286 WP_000284050.1.65296 WP_000284050.1.65305 WP_000284050.1.65306 WP_000284050.1.65353 WP_000284050.1.65355 WP_000284050.1.65364 WP_000284050.1.6537 WP_000284050.1.65370 WP_000284050.1.65372 WP_000284050.1.654 WP_000284050.1.65405 WP_000284050.1.65408 WP_000284050.1.65413 WP_000284050.1.65415 WP_000284050.1.65456 WP_000284050.1.65484 WP_000284050.1.65493 WP_000284050.1.6553 WP_000284050.1.65531 WP_000284050.1.65546 WP_000284050.1.65565 WP_000284050.1.65571 WP_000284050.1.65581 WP_000284050.1.65596 WP_000284050.1.65606 WP_000284050.1.6563 WP_000284050.1.65662 WP_000284050.1.65667 WP_000284050.1.65672 WP_000284050.1.65677 WP_000284050.1.65714 WP_000284050.1.6576 WP_000284050.1.65762 WP_000284050.1.65834 WP_000284050.1.6587 WP_000284050.1.65875 WP_000284050.1.65898 WP_000284050.1.65912 WP_000284050.1.65954 WP_000284050.1.65957 WP_000284050.1.65961 WP_000284050.1.65962 WP_000284050.1.65963 WP_000284050.1.65976 WP_000284050.1.65978 WP_000284050.1.65988 WP_000284050.1.6599 WP_000284050.1.65991 WP_000284050.1.66001 WP_000284050.1.66007 WP_000284050.1.66016 WP_000284050.1.66017 WP_000284050.1.66022 WP_000284050.1.66033 WP_000284050.1.6604 WP_000284050.1.66044 WP_000284050.1.66050 WP_000284050.1.66059 WP_000284050.1.66071 WP_000284050.1.6609 WP_000284050.1.66094 WP_000284050.1.66100 WP_000284050.1.66102 WP_000284050.1.66104 WP_000284050.1.66105 WP_000284050.1.66121 WP_000284050.1.66127 WP_000284050.1.66161 WP_000284050.1.6618 WP_000284050.1.66181 WP_000284050.1.66187 WP_000284050.1.66197 WP_000284050.1.6622 WP_000284050.1.66251 WP_000284050.1.66255 WP_000284050.1.66264 WP_000284050.1.66280 WP_000284050.1.66288 WP_000284050.1.66290 WP_000284050.1.66295 WP_000284050.1.66327 WP_000284050.1.66335 WP_000284050.1.6635 WP_000284050.1.66376 WP_000284050.1.66387 WP_000284050.1.66389 WP_000284050.1.66392 WP_000284050.1.66395 WP_000284050.1.66412 WP_000284050.1.66421 WP_000284050.1.66432 WP_000284050.1.66448 WP_000284050.1.6645 WP_000284050.1.66501 WP_000284050.1.66511 WP_000284050.1.66523 WP_000284050.1.66531 WP_000284050.1.6654 WP_000284050.1.66550 WP_000284050.1.66559 WP_000284050.1.66566 WP_000284050.1.66579 WP_000284050.1.66624 WP_000284050.1.66644 WP_000284050.1.6665 WP_000284050.1.6666 WP_000284050.1.66668 WP_000284050.1.66700 WP_000284050.1.66706 WP_000284050.1.66708 WP_000284050.1.66719 WP_000284050.1.66727 WP_000284050.1.66751 WP_000284050.1.66758 WP_000284050.1.6676 WP_000284050.1.66783 WP_000284050.1.66787 WP_000284050.1.66791 WP_000284050.1.66794 WP_000284050.1.66795 WP_000284050.1.66796 WP_000284050.1.66849 WP_000284050.1.66873 WP_000284050.1.66922 WP_000284050.1.66926 WP_000284050.1.66933 WP_000284050.1.66948 WP_000284050.1.66975 WP_000284050.1.66978 WP_000284050.1.6698 WP_000284050.1.66984 WP_000284050.1.6701 WP_000284050.1.67018 WP_000284050.1.67021 WP_000284050.1.67022 WP_000284050.1.67026 WP_000284050.1.67029 WP_000284050.1.67035 WP_000284050.1.67047 WP_000284050.1.67055 WP_000284050.1.6706 WP_000284050.1.67073 WP_000284050.1.67102 WP_000284050.1.67116 WP_000284050.1.67120 WP_000284050.1.67132 WP_000284050.1.67136 WP_000284050.1.67137 WP_000284050.1.67149 WP_000284050.1.67150 WP_000284050.1.67153 WP_000284050.1.67164 WP_000284050.1.67174 WP_000284050.1.67193 WP_000284050.1.67194 WP_000284050.1.67200 WP_000284050.1.67209 WP_000284050.1.67210 WP_000284050.1.67214 WP_000284050.1.6723 WP_000284050.1.67258 WP_000284050.1.67272 WP_000284050.1.67278 WP_000284050.1.67284 WP_000284050.1.67293 WP_000284050.1.6735 WP_000284050.1.67373 WP_000284050.1.67383 WP_000284050.1.67412 WP_000284050.1.67415 WP_000284050.1.67427 WP_000284050.1.67446 WP_000284050.1.67451 WP_000284050.1.67452 WP_000284050.1.67454 WP_000284050.1.67462 WP_000284050.1.67464 WP_000284050.1.67467 WP_000284050.1.67468 WP_000284050.1.67495 WP_000284050.1.67522 WP_000284050.1.67533 WP_000284050.1.67538 WP_000284050.1.67549 WP_000284050.1.67553 WP_000284050.1.67581 WP_000284050.1.67590 WP_000284050.1.67606 WP_000284050.1.67660 WP_000284050.1.67663 WP_000284050.1.67676 WP_000284050.1.67681 WP_000284050.1.67685 WP_000284050.1.6769 WP_000284050.1.67690 WP_000284050.1.67701 WP_000284050.1.67704 WP_000284050.1.67724 WP_000284050.1.67726 WP_000284050.1.67732 WP_000284050.1.67737 WP_000284050.1.67753 WP_000284050.1.67760 WP_000284050.1.67775 WP_000284050.1.67780 WP_000284050.1.67786 WP_000284050.1.67788 WP_000284050.1.678 WP_000284050.1.67810 WP_000284050.1.67841 WP_000284050.1.67853 WP_000284050.1.67861 WP_000284050.1.67891 WP_000284050.1.67894 WP_000284050.1.67901 WP_000284050.1.6793 WP_000284050.1.67938 WP_000284050.1.67971 WP_000284050.1.67975 WP_000284050.1.67984 WP_000284050.1.67990 WP_000284050.1.67992 WP_000284050.1.67999 WP_000284050.1.68008 WP_000284050.1.68011 WP_000284050.1.68012 WP_000284050.1.6802 WP_000284050.1.68025 WP_000284050.1.6803 WP_000284050.1.68039 WP_000284050.1.68052 WP_000284050.1.68053 WP_000284050.1.68058 WP_000284050.1.68059 WP_000284050.1.68063 WP_000284050.1.68067 WP_000284050.1.68069 WP_000284050.1.68070 WP_000284050.1.68079 WP_000284050.1.68096 WP_000284050.1.6810 WP_000284050.1.68108 WP_000284050.1.68126 WP_000284050.1.68138 WP_000284050.1.6814 WP_000284050.1.68145 WP_000284050.1.68157 WP_000284050.1.68170 WP_000284050.1.68175 WP_000284050.1.68177 WP_000284050.1.682 WP_000284050.1.68200 WP_000284050.1.68215 WP_000284050.1.68231 WP_000284050.1.68241 WP_000284050.1.68255 WP_000284050.1.68271 WP_000284050.1.68278 WP_000284050.1.68279 WP_000284050.1.68281 WP_000284050.1.68283 WP_000284050.1.68292 WP_000284050.1.68300 WP_000284050.1.68336 WP_000284050.1.68341 WP_000284050.1.68347 WP_000284050.1.68362 WP_000284050.1.68369 WP_000284050.1.68372 WP_000284050.1.68395 WP_000284050.1.68396 WP_000284050.1.68411 WP_000284050.1.68441 WP_000284050.1.68442 WP_000284050.1.68482 WP_000284050.1.68490 WP_000284050.1.68493 WP_000284050.1.68523 WP_000284050.1.68524 WP_000284050.1.68534 WP_000284050.1.68566 WP_000284050.1.68572 WP_000284050.1.68584 WP_000284050.1.6859 WP_000284050.1.68598 WP_000284050.1.6860 WP_000284050.1.68609 WP_000284050.1.68630 WP_000284050.1.68632 WP_000284050.1.68635 WP_000284050.1.68673 WP_000284050.1.68678 WP_000284050.1.68679 WP_000284050.1.68695 WP_000284050.1.68697 WP_000284050.1.68701 WP_000284050.1.68711 WP_000284050.1.68731 WP_000284050.1.68735 WP_000284050.1.68750 WP_000284050.1.68751 WP_000284050.1.68752 WP_000284050.1.6877 WP_000284050.1.68793 WP_000284050.1.68795 WP_000284050.1.68797 WP_000284050.1.6880 WP_000284050.1.68801 WP_000284050.1.68838 WP_000284050.1.68847 WP_000284050.1.68865 WP_000284050.1.6887 WP_000284050.1.68873 WP_000284050.1.68877 WP_000284050.1.68880 WP_000284050.1.68911 WP_000284050.1.68924 WP_000284050.1.68936 WP_000284050.1.68942 WP_000284050.1.68952 WP_000284050.1.68956 WP_000284050.1.68961 WP_000284050.1.6897 WP_000284050.1.68989 WP_000284050.1.68995 WP_000284050.1.69033 WP_000284050.1.69039 WP_000284050.1.69054 WP_000284050.1.69126 WP_000284050.1.69127 WP_000284050.1.69144 WP_000284050.1.69158 WP_000284050.1.6916 WP_000284050.1.69160 WP_000284050.1.6919 WP_000284050.1.69192 WP_000284050.1.6921 WP_000284050.1.69221 WP_000284050.1.6923 WP_000284050.1.69247 WP_000284050.1.69258 WP_000284050.1.69261 WP_000284050.1.6929 WP_000284050.1.69303 WP_000284050.1.69305 WP_000284050.1.69327 WP_000284050.1.69341 WP_000284050.1.69350 WP_000284050.1.69351 WP_000284050.1.69382 WP_000284050.1.69390 WP_000284050.1.694 WP_000284050.1.69404 WP_000284050.1.69438 WP_000284050.1.69441 WP_000284050.1.6945 WP_000284050.1.69450 WP_000284050.1.69472 WP_000284050.1.69473 WP_000284050.1.69502 WP_000284050.1.69506 WP_000284050.1.69537 WP_000284050.1.69551 WP_000284050.1.69583 WP_000284050.1.69589 WP_000284050.1.69593 WP_000284050.1.69596 WP_000284050.1.69605 WP_000284050.1.69643 WP_000284050.1.69646 WP_000284050.1.69649 WP_000284050.1.69655 WP_000284050.1.697 WP_000284050.1.69716 WP_000284050.1.69730 WP_000284050.1.69735 WP_000284050.1.69780 WP_000284050.1.69786 WP_000284050.1.69803 WP_000284050.1.69810 WP_000284050.1.69818 WP_000284050.1.69831 WP_000284050.1.69832 WP_000284050.1.69868 WP_000284050.1.69887 WP_000284050.1.69896 WP_000284050.1.6993 WP_000284050.1.69963 WP_000284050.1.69972 WP_000284050.1.69979 WP_000284050.1.69999 WP_000284050.1.7001 WP_000284050.1.70041 WP_000284050.1.70063 WP_000284050.1.70081 WP_000284050.1.701 WP_000284050.1.70123 WP_000284050.1.70125 WP_000284050.1.7013 WP_000284050.1.70149 WP_000284050.1.7015 WP_000284050.1.70190 WP_000284050.1.70191 WP_000284050.1.70200 WP_000284050.1.70213 WP_000284050.1.70230 WP_000284050.1.70251 WP_000284050.1.70256 WP_000284050.1.70264 WP_000284050.1.70300 WP_000284050.1.70337 WP_000284050.1.70341 WP_000284050.1.70357 WP_000284050.1.70370 WP_000284050.1.70386 WP_000284050.1.70407 WP_000284050.1.70408 WP_000284050.1.70414 WP_000284050.1.70477 WP_000284050.1.70492 WP_000284050.1.7050 WP_000284050.1.70509 WP_000284050.1.70517 WP_000284050.1.7052 WP_000284050.1.70530 WP_000284050.1.70539 WP_000284050.1.70563 WP_000284050.1.70576 WP_000284050.1.70578 WP_000284050.1.70582 WP_000284050.1.70592 WP_000284050.1.70597 WP_000284050.1.70600 WP_000284050.1.70628 WP_000284050.1.70655 WP_000284050.1.70656 WP_000284050.1.70686 WP_000284050.1.70694 WP_000284050.1.70698 WP_000284050.1.70705 WP_000284050.1.70713 WP_000284050.1.70723 WP_000284050.1.70728 WP_000284050.1.70745 WP_000284050.1.70747 WP_000284050.1.70748 WP_000284050.1.70767 WP_000284050.1.70787 WP_000284050.1.70794 WP_000284050.1.70801 WP_000284050.1.70803 WP_000284050.1.70880 WP_000284050.1.70896 WP_000284050.1.7090 WP_000284050.1.70900 WP_000284050.1.70952 WP_000284050.1.70967 WP_000284050.1.71003 WP_000284050.1.71024 WP_000284050.1.71037 WP_000284050.1.71042 WP_000284050.1.71062 WP_000284050.1.71099 WP_000284050.1.71109 WP_000284050.1.71113 WP_000284050.1.71134 WP_000284050.1.71139 WP_000284050.1.71144 WP_000284050.1.71147 WP_000284050.1.71149 WP_000284050.1.71158 WP_000284050.1.71159 WP_000284050.1.71162 WP_000284050.1.71170 WP_000284050.1.71176 WP_000284050.1.71183 WP_000284050.1.71192 WP_000284050.1.71199 WP_000284050.1.71205 WP_000284050.1.7121 WP_000284050.1.71221 WP_000284050.1.71223 WP_000284050.1.71225 WP_000284050.1.71226 WP_000284050.1.71229 WP_000284050.1.71264 WP_000284050.1.71269 WP_000284050.1.71272 WP_000284050.1.71273 WP_000284050.1.71275 WP_000284050.1.71285 WP_000284050.1.71287 WP_000284050.1.71294 WP_000284050.1.71311 WP_000284050.1.71312 WP_000284050.1.71315 WP_000284050.1.71323 WP_000284050.1.71327 WP_000284050.1.71339 WP_000284050.1.71354 WP_000284050.1.71397 WP_000284050.1.71403 WP_000284050.1.71405 WP_000284050.1.71409 WP_000284050.1.71421 WP_000284050.1.71423 WP_000284050.1.71448 WP_000284050.1.7147 WP_000284050.1.71480 WP_000284050.1.71522 WP_000284050.1.71533 WP_000284050.1.71537 WP_000284050.1.71538 WP_000284050.1.71540 WP_000284050.1.71560 WP_000284050.1.71562 WP_000284050.1.71563 WP_000284050.1.71603 WP_000284050.1.71607 WP_000284050.1.71632 WP_000284050.1.71680 WP_000284050.1.71690 WP_000284050.1.71695 WP_000284050.1.71712 WP_000284050.1.71724 WP_000284050.1.71732 WP_000284050.1.71757 WP_000284050.1.71767 WP_000284050.1.71783 WP_000284050.1.71830 WP_000284050.1.71832 WP_000284050.1.71837 WP_000284050.1.71840 WP_000284050.1.71855 WP_000284050.1.71856 WP_000284050.1.71874 WP_000284050.1.7192 WP_000284050.1.71922 WP_000284050.1.71939 WP_000284050.1.71940 WP_000284050.1.71944 WP_000284050.1.71945 WP_000284050.1.71967 WP_000284050.1.71972 WP_000284050.1.71975 WP_000284050.1.71987 WP_000284050.1.71993 WP_000284050.1.72013 WP_000284050.1.72016 WP_000284050.1.72021 WP_000284050.1.72028 WP_000284050.1.72033 WP_000284050.1.72048 WP_000284050.1.7205 WP_000284050.1.72053 WP_000284050.1.72054 WP_000284050.1.72066 WP_000284050.1.72090 WP_000284050.1.72098 WP_000284050.1.7210 WP_000284050.1.72117 WP_000284050.1.72120 WP_000284050.1.72125 WP_000284050.1.72126 WP_000284050.1.72141 WP_000284050.1.72153 WP_000284050.1.72155 WP_000284050.1.72157 WP_000284050.1.72161 WP_000284050.1.72162 WP_000284050.1.72180 WP_000284050.1.72186 WP_000284050.1.72208 WP_000284050.1.72212 WP_000284050.1.72237 WP_000284050.1.72240 WP_000284050.1.72248 WP_000284050.1.7225 WP_000284050.1.72258 WP_000284050.1.72261 WP_000284050.1.72262 WP_000284050.1.72270 WP_000284050.1.72279 WP_000284050.1.72290 WP_000284050.1.72293 WP_000284050.1.72298 WP_000284050.1.723 WP_000284050.1.72316 WP_000284050.1.72322 WP_000284050.1.72337 WP_000284050.1.72342 WP_000284050.1.72352 WP_000284050.1.72359 WP_000284050.1.72362 WP_000284050.1.72388 WP_000284050.1.72391 WP_000284050.1.72392 WP_000284050.1.72397 WP_000284050.1.72414 WP_000284050.1.72425 WP_000284050.1.72427 WP_000284050.1.72431 WP_000284050.1.72436 WP_000284050.1.72449 WP_000284050.1.72469 WP_000284050.1.72485 WP_000284050.1.72493 WP_000284050.1.72507 WP_000284050.1.72511 WP_000284050.1.72521 WP_000284050.1.72522 WP_000284050.1.72535 WP_000284050.1.72537 WP_000284050.1.72544 WP_000284050.1.72551 WP_000284050.1.72574 WP_000284050.1.72582 WP_000284050.1.72588 WP_000284050.1.72593 WP_000284050.1.72596 WP_000284050.1.72599 WP_000284050.1.72606 WP_000284050.1.72608 WP_000284050.1.72614 WP_000284050.1.72615 WP_000284050.1.72616 WP_000284050.1.72619 WP_000284050.1.72641 WP_000284050.1.72643 WP_000284050.1.72651 WP_000284050.1.72652 WP_000284050.1.72663 WP_000284050.1.72694 WP_000284050.1.72695 WP_000284050.1.72698 WP_000284050.1.72700 WP_000284050.1.72706 WP_000284050.1.72725 WP_000284050.1.72729 WP_000284050.1.72738 WP_000284050.1.72745 WP_000284050.1.72747 WP_000284050.1.72748 WP_000284050.1.72751 WP_000284050.1.72758 WP_000284050.1.72764 WP_000284050.1.7277 WP_000284050.1.72778 WP_000284050.1.72804 WP_000284050.1.72806 WP_000284050.1.7281 WP_000284050.1.72837 WP_000284050.1.72858 WP_000284050.1.72860 WP_000284050.1.72869 WP_000284050.1.72893 WP_000284050.1.7291 WP_000284050.1.72910 WP_000284050.1.72913 WP_000284050.1.72950 WP_000284050.1.72956 WP_000284050.1.72962 WP_000284050.1.72998 WP_000284050.1.73000 WP_000284050.1.73010 WP_000284050.1.73015 WP_000284050.1.73032 WP_000284050.1.73039 WP_000284050.1.73061 WP_000284050.1.7307 WP_000284050.1.73072 WP_000284050.1.73075 WP_000284050.1.73085 WP_000284050.1.7309 WP_000284050.1.73094 WP_000284050.1.73126 WP_000284050.1.73129 WP_000284050.1.73193 WP_000284050.1.73197 WP_000284050.1.73215 WP_000284050.1.73217 WP_000284050.1.73230 WP_000284050.1.73239 WP_000284050.1.73243 WP_000284050.1.73249 WP_000284050.1.73251 WP_000284050.1.73257 WP_000284050.1.73259 WP_000284050.1.73277 WP_000284050.1.73278 WP_000284050.1.73283 WP_000284050.1.73291 WP_000284050.1.73292 WP_000284050.1.73295 WP_000284050.1.73326 WP_000284050.1.73333 WP_000284050.1.73340 WP_000284050.1.73343 WP_000284050.1.73344 WP_000284050.1.73349 WP_000284050.1.73385 WP_000284050.1.73393 WP_000284050.1.73428 WP_000284050.1.7345 WP_000284050.1.73468 WP_000284050.1.73486 WP_000284050.1.7349 WP_000284050.1.73498 WP_000284050.1.73565 WP_000284050.1.73572 WP_000284050.1.73592 WP_000284050.1.73604 WP_000284050.1.73626 WP_000284050.1.73631 WP_000284050.1.73652 WP_000284050.1.73663 WP_000284050.1.73700 WP_000284050.1.73709 WP_000284050.1.73717 WP_000284050.1.73743 WP_000284050.1.73748 WP_000284050.1.7376 WP_000284050.1.73783 WP_000284050.1.73785 WP_000284050.1.73797 WP_000284050.1.73801 WP_000284050.1.73807 WP_000284050.1.73811 WP_000284050.1.73827 WP_000284050.1.73835 WP_000284050.1.73843 WP_000284050.1.73859 WP_000284050.1.73882 WP_000284050.1.73897 WP_000284050.1.73908 WP_000284050.1.7392 WP_000284050.1.73934 WP_000284050.1.73942 WP_000284050.1.73968 WP_000284050.1.73980 WP_000284050.1.73992 WP_000284050.1.73995 WP_000284050.1.73996 WP_000284050.1.74032 WP_000284050.1.74041 WP_000284050.1.74045 WP_000284050.1.74046 WP_000284050.1.74051 WP_000284050.1.74053 WP_000284050.1.7407 WP_000284050.1.7411 WP_000284050.1.74123 WP_000284050.1.7413 WP_000284050.1.74156 WP_000284050.1.74184 WP_000284050.1.74185 WP_000284050.1.74213 WP_000284050.1.74223 WP_000284050.1.7424 WP_000284050.1.74243 WP_000284050.1.7425 WP_000284050.1.74251 WP_000284050.1.74267 WP_000284050.1.7429 WP_000284050.1.74294 WP_000284050.1.74309 WP_000284050.1.74358 WP_000284050.1.74365 WP_000284050.1.74367 WP_000284050.1.744 WP_000284050.1.74423 WP_000284050.1.74426 WP_000284050.1.74431 WP_000284050.1.74444 WP_000284050.1.7446 WP_000284050.1.74465 WP_000284050.1.74478 WP_000284050.1.74491 WP_000284050.1.74501 WP_000284050.1.74509 WP_000284050.1.74513 WP_000284050.1.74521 WP_000284050.1.74528 WP_000284050.1.74532 WP_000284050.1.74536 WP_000284050.1.74549 WP_000284050.1.74557 WP_000284050.1.7461 WP_000284050.1.74611 WP_000284050.1.74623 WP_000284050.1.74624 WP_000284050.1.74625 WP_000284050.1.74631 WP_000284050.1.74652 WP_000284050.1.74670 WP_000284050.1.74682 WP_000284050.1.74687 WP_000284050.1.74688 WP_000284050.1.74689 WP_000284050.1.74691 WP_000284050.1.74705 WP_000284050.1.7471 WP_000284050.1.74713 WP_000284050.1.74716 WP_000284050.1.74735 WP_000284050.1.7475 WP_000284050.1.74752 WP_000284050.1.74765 WP_000284050.1.74767 WP_000284050.1.7478 WP_000284050.1.7479 WP_000284050.1.74793 WP_000284050.1.74811 WP_000284050.1.74828 WP_000284050.1.74844 WP_000284050.1.74852 WP_000284050.1.74854 WP_000284050.1.74860 WP_000284050.1.74867 WP_000284050.1.74873 WP_000284050.1.74879 WP_000284050.1.74880 WP_000284050.1.74885 WP_000284050.1.74889 WP_000284050.1.74895 WP_000284050.1.74904 WP_000284050.1.74914 WP_000284050.1.74915 WP_000284050.1.74962 WP_000284050.1.74975 WP_000284050.1.74993 WP_000284050.1.74998 WP_000284050.1.75021 WP_000284050.1.75029 WP_000284050.1.75030 WP_000284050.1.75050 WP_000284050.1.75087 WP_000284050.1.75100 WP_000284050.1.75112 WP_000284050.1.75118 WP_000284050.1.75124 WP_000284050.1.75136 WP_000284050.1.75138 WP_000284050.1.75139 WP_000284050.1.75143 WP_000284050.1.75145 WP_000284050.1.75149 WP_000284050.1.75155 WP_000284050.1.7516 WP_000284050.1.75164 WP_000284050.1.75181 WP_000284050.1.75209 WP_000284050.1.75218 WP_000284050.1.75219 WP_000284050.1.75221 WP_000284050.1.75228 WP_000284050.1.75243 WP_000284050.1.75247 WP_000284050.1.75248 WP_000284050.1.75254 WP_000284050.1.75270 WP_000284050.1.75272 WP_000284050.1.75306 WP_000284050.1.7536 WP_000284050.1.75360 WP_000284050.1.75367 WP_000284050.1.75382 WP_000284050.1.7539 WP_000284050.1.75419 WP_000284050.1.75428 WP_000284050.1.75435 WP_000284050.1.75465 WP_000284050.1.75491 WP_000284050.1.75505 WP_000284050.1.75507 WP_000284050.1.75515 WP_000284050.1.75529 WP_000284050.1.75536 WP_000284050.1.75537 WP_000284050.1.75557 WP_000284050.1.75568 WP_000284050.1.75577 WP_000284050.1.75588 WP_000284050.1.75594 WP_000284050.1.75602 WP_000284050.1.75612 WP_000284050.1.75629 WP_000284050.1.75644 WP_000284050.1.75653 WP_000284050.1.75672 WP_000284050.1.75676 WP_000284050.1.75679 WP_000284050.1.75687 WP_000284050.1.75694 WP_000284050.1.75696 WP_000284050.1.75698 WP_000284050.1.75699 WP_000284050.1.75725 WP_000284050.1.75735 WP_000284050.1.75758 WP_000284050.1.75767 WP_000284050.1.75786 WP_000284050.1.75803 WP_000284050.1.75808 WP_000284050.1.7583 WP_000284050.1.75839 WP_000284050.1.75853 WP_000284050.1.75892 WP_000284050.1.75918 WP_000284050.1.75922 WP_000284050.1.7597 WP_000284050.1.75973 WP_000284050.1.75983 WP_000284050.1.75989 WP_000284050.1.75995 WP_000284050.1.75999 WP_000284050.1.76005 WP_000284050.1.76009 WP_000284050.1.76019 WP_000284050.1.7603 WP_000284050.1.76030 WP_000284050.1.76036 WP_000284050.1.76039 WP_000284050.1.76054 WP_000284050.1.76057 WP_000284050.1.7608 WP_000284050.1.76087 WP_000284050.1.76089 WP_000284050.1.76103 WP_000284050.1.76118 WP_000284050.1.76119 WP_000284050.1.76129 WP_000284050.1.7613 WP_000284050.1.76152 WP_000284050.1.7617 WP_000284050.1.76184 WP_000284050.1.76189 WP_000284050.1.76194 WP_000284050.1.76196 WP_000284050.1.76211 WP_000284050.1.76237 WP_000284050.1.76268 WP_000284050.1.76269 WP_000284050.1.76305 WP_000284050.1.76312 WP_000284050.1.76325 WP_000284050.1.76335 WP_000284050.1.76361 WP_000284050.1.7637 WP_000284050.1.76376 WP_000284050.1.76384 WP_000284050.1.76387 WP_000284050.1.76390 WP_000284050.1.76407 WP_000284050.1.76446 WP_000284050.1.76447 WP_000284050.1.76448 WP_000284050.1.76452 WP_000284050.1.76460 WP_000284050.1.76462 WP_000284050.1.76466 WP_000284050.1.76469 WP_000284050.1.76477 WP_000284050.1.76504 WP_000284050.1.76542 WP_000284050.1.76544 WP_000284050.1.76547 WP_000284050.1.76562 WP_000284050.1.76595 WP_000284050.1.76596 WP_000284050.1.7661 WP_000284050.1.76612 WP_000284050.1.76619 WP_000284050.1.76643 WP_000284050.1.76656 WP_000284050.1.76660 WP_000284050.1.76697 WP_000284050.1.76701 WP_000284050.1.76705 WP_000284050.1.76707 WP_000284050.1.76712 WP_000284050.1.76751 WP_000284050.1.76759 WP_000284050.1.7680 WP_000284050.1.76815 WP_000284050.1.76827 WP_000284050.1.76831 WP_000284050.1.76840 WP_000284050.1.76863 WP_000284050.1.76884 WP_000284050.1.7689 WP_000284050.1.76909 WP_000284050.1.76918 WP_000284050.1.76933 WP_000284050.1.76948 WP_000284050.1.76957 WP_000284050.1.76961 WP_000284050.1.76965 WP_000284050.1.76966 WP_000284050.1.7699 WP_000284050.1.76994 WP_000284050.1.77007 WP_000284050.1.77015 WP_000284050.1.77022 WP_000284050.1.77036 WP_000284050.1.77042 WP_000284050.1.77057 WP_000284050.1.77070 WP_000284050.1.77081 WP_000284050.1.77099 WP_000284050.1.771 WP_000284050.1.77109 WP_000284050.1.77120 WP_000284050.1.77128 WP_000284050.1.77134 WP_000284050.1.77147 WP_000284050.1.77162 WP_000284050.1.77173 WP_000284050.1.77175 WP_000284050.1.77198 WP_000284050.1.77200 WP_000284050.1.77204 WP_000284050.1.77214 WP_000284050.1.77224 WP_000284050.1.77239 WP_000284050.1.77258 WP_000284050.1.77275 WP_000284050.1.7728 WP_000284050.1.77284 WP_000284050.1.77288 WP_000284050.1.7729 WP_000284050.1.77290 WP_000284050.1.77291 WP_000284050.1.77296 WP_000284050.1.7731 WP_000284050.1.77320 WP_000284050.1.77326 WP_000284050.1.77341 WP_000284050.1.77358 WP_000284050.1.77391 WP_000284050.1.77392 WP_000284050.1.77408 WP_000284050.1.77432 WP_000284050.1.77437 WP_000284050.1.77448 WP_000284050.1.77452 WP_000284050.1.77455 WP_000284050.1.77462 WP_000284050.1.7747 WP_000284050.1.77470 WP_000284050.1.77471 WP_000284050.1.77477 WP_000284050.1.77481 WP_000284050.1.77487 WP_000284050.1.77495 WP_000284050.1.775 WP_000284050.1.7750 WP_000284050.1.77503 WP_000284050.1.77511 WP_000284050.1.77542 WP_000284050.1.77551 WP_000284050.1.7756 WP_000284050.1.77577 WP_000284050.1.77581 WP_000284050.1.77595 WP_000284050.1.77600 WP_000284050.1.77608 WP_000284050.1.77626 WP_000284050.1.77632 WP_000284050.1.77643 WP_000284050.1.77644 WP_000284050.1.77648 WP_000284050.1.77707 WP_000284050.1.77725 WP_000284050.1.77741 WP_000284050.1.7775 WP_000284050.1.77760 WP_000284050.1.77767 WP_000284050.1.77768 WP_000284050.1.7780 WP_000284050.1.7781 WP_000284050.1.77813 WP_000284050.1.77816 WP_000284050.1.77826 WP_000284050.1.77833 WP_000284050.1.77876 WP_000284050.1.77929 WP_000284050.1.77949 WP_000284050.1.77961 WP_000284050.1.77979 WP_000284050.1.7799 WP_000284050.1.77999 WP_000284050.1.78000 WP_000284050.1.78007 WP_000284050.1.78010 WP_000284050.1.7804 WP_000284050.1.78041 WP_000284050.1.78059 WP_000284050.1.7806 WP_000284050.1.78063 WP_000284050.1.7808 WP_000284050.1.78089 WP_000284050.1.78097 WP_000284050.1.78099 WP_000284050.1.78101 WP_000284050.1.78102 WP_000284050.1.78131 WP_000284050.1.78183 WP_000284050.1.78187 WP_000284050.1.78196 WP_000284050.1.78202 WP_000284050.1.78232 WP_000284050.1.78233 WP_000284050.1.78235 WP_000284050.1.78297 WP_000284050.1.78305 WP_000284050.1.78321 WP_000284050.1.78337 WP_000284050.1.78340 WP_000284050.1.78368 WP_000284050.1.78376 WP_000284050.1.78377 WP_000284050.1.78390 WP_000284050.1.784 WP_000284050.1.78413 WP_000284050.1.78445 WP_000284050.1.78453 WP_000284050.1.78462 WP_000284050.1.78463 WP_000284050.1.7847 WP_000284050.1.78477 WP_000284050.1.78481 WP_000284050.1.78491 WP_000284050.1.7851 WP_000284050.1.78512 WP_000284050.1.78515 WP_000284050.1.78527 WP_000284050.1.7855 WP_000284050.1.78553 WP_000284050.1.78572 WP_000284050.1.78575 WP_000284050.1.78581 WP_000284050.1.78583 WP_000284050.1.78586 WP_000284050.1.78593 WP_000284050.1.78610 WP_000284050.1.78611 WP_000284050.1.78612 WP_000284050.1.78615 WP_000284050.1.78622 WP_000284050.1.78645 WP_000284050.1.78677 WP_000284050.1.78683 WP_000284050.1.78687 WP_000284050.1.78689 WP_000284050.1.78696 WP_000284050.1.78698 WP_000284050.1.78714 WP_000284050.1.78718 WP_000284050.1.78746 WP_000284050.1.78750 WP_000284050.1.78757 WP_000284050.1.78773 WP_000284050.1.78775 WP_000284050.1.78791 WP_000284050.1.78814 WP_000284050.1.7883 WP_000284050.1.78843 WP_000284050.1.78845 WP_000284050.1.78854 WP_000284050.1.78888 WP_000284050.1.78891 WP_000284050.1.78893 WP_000284050.1.78895 WP_000284050.1.78908 WP_000284050.1.78919 WP_000284050.1.78953 WP_000284050.1.78955 WP_000284050.1.78956 WP_000284050.1.7896 WP_000284050.1.78966 WP_000284050.1.7898 WP_000284050.1.78996 WP_000284050.1.79001 WP_000284050.1.79002 WP_000284050.1.79004 WP_000284050.1.7901 WP_000284050.1.79065 WP_000284050.1.79067 WP_000284050.1.79075 WP_000284050.1.79086 WP_000284050.1.79088 WP_000284050.1.79090 WP_000284050.1.79092 WP_000284050.1.79100 WP_000284050.1.79126 WP_000284050.1.79159 WP_000284050.1.79172 WP_000284050.1.79226 WP_000284050.1.79233 WP_000284050.1.79243 WP_000284050.1.79248 WP_000284050.1.79249 WP_000284050.1.79276 WP_000284050.1.79308 WP_000284050.1.79312 WP_000284050.1.79342 WP_000284050.1.79343 WP_000284050.1.79346 WP_000284050.1.79348 WP_000284050.1.79356 WP_000284050.1.79365 WP_000284050.1.79368 WP_000284050.1.79369 WP_000284050.1.7937 WP_000284050.1.79389 WP_000284050.1.79391 WP_000284050.1.7940 WP_000284050.1.79409 WP_000284050.1.79414 WP_000284050.1.79416 WP_000284050.1.79443 WP_000284050.1.79464 WP_000284050.1.79478 WP_000284050.1.79505 WP_000284050.1.79519 WP_000284050.1.7952 WP_000284050.1.79525 WP_000284050.1.79526 WP_000284050.1.79528 WP_000284050.1.79540 WP_000284050.1.79558 WP_000284050.1.79563 WP_000284050.1.79576 WP_000284050.1.79591 WP_000284050.1.79606 WP_000284050.1.79619 WP_000284050.1.79640 WP_000284050.1.7967 WP_000284050.1.79685 WP_000284050.1.79713 WP_000284050.1.79715 WP_000284050.1.79759 WP_000284050.1.79764 WP_000284050.1.79800 WP_000284050.1.79816 WP_000284050.1.79824 WP_000284050.1.79840 WP_000284050.1.7985 WP_000284050.1.79866 WP_000284050.1.79869 WP_000284050.1.7987 WP_000284050.1.79871 WP_000284050.1.79877 WP_000284050.1.79905 WP_000284050.1.79922 WP_000284050.1.7993 WP_000284050.1.79930 WP_000284050.1.79931 WP_000284050.1.79932 WP_000284050.1.79933 WP_000284050.1.79936 WP_000284050.1.79944 WP_000284050.1.79952 WP_000284050.1.79955 WP_000284050.1.79965 WP_000284050.1.79973 WP_000284050.1.79984 WP_000284050.1.79995 WP_000284050.1.80 WP_000284050.1.80011 WP_000284050.1.80016 WP_000284050.1.80026 WP_000284050.1.8004 WP_000284050.1.80043 WP_000284050.1.80050 WP_000284050.1.80060 WP_000284050.1.80061 WP_000284050.1.80063 WP_000284050.1.8007 WP_000284050.1.80071 WP_000284050.1.80096 WP_000284050.1.80106 WP_000284050.1.8011 WP_000284050.1.80112 WP_000284050.1.80136 WP_000284050.1.80141 WP_000284050.1.80168 WP_000284050.1.80176 WP_000284050.1.80179 WP_000284050.1.80183 WP_000284050.1.80192 WP_000284050.1.80255 WP_000284050.1.80292 WP_000284050.1.80309 WP_000284050.1.80310 WP_000284050.1.80320 WP_000284050.1.80330 WP_000284050.1.80388 WP_000284050.1.80392 WP_000284050.1.804 WP_000284050.1.80402 WP_000284050.1.80426 WP_000284050.1.80428 WP_000284050.1.80440 WP_000284050.1.80444 WP_000284050.1.80456 WP_000284050.1.80463 WP_000284050.1.80484 WP_000284050.1.80517 WP_000284050.1.80519 WP_000284050.1.80524 WP_000284050.1.80545 WP_000284050.1.80558 WP_000284050.1.80559 WP_000284050.1.8057 WP_000284050.1.80577 WP_000284050.1.80578 WP_000284050.1.80594 WP_000284050.1.80606 WP_000284050.1.80612 WP_000284050.1.80626 WP_000284050.1.80660 WP_000284050.1.80662 WP_000284050.1.80666 WP_000284050.1.80676 WP_000284050.1.8068 WP_000284050.1.80709 WP_000284050.1.80718 WP_000284050.1.80731 WP_000284050.1.80736 WP_000284050.1.80737 WP_000284050.1.8074 WP_000284050.1.80753 WP_000284050.1.80754 WP_000284050.1.80756 WP_000284050.1.8076 WP_000284050.1.80768 WP_000284050.1.80789 WP_000284050.1.808 WP_000284050.1.80804 WP_000284050.1.80805 WP_000284050.1.80843 WP_000284050.1.80862 WP_000284050.1.80882 WP_000284050.1.80894 WP_000284050.1.8090 WP_000284050.1.8091 WP_000284050.1.80935 WP_000284050.1.80945 WP_000284050.1.80946 WP_000284050.1.80948 WP_000284050.1.80954 WP_000284050.1.80966 WP_000284050.1.80983 WP_000284050.1.80985 WP_000284050.1.810 WP_000284050.1.81026 WP_000284050.1.81032 WP_000284050.1.81034 WP_000284050.1.81036 WP_000284050.1.81054 WP_000284050.1.81056 WP_000284050.1.81070 WP_000284050.1.81071 WP_000284050.1.81098 WP_000284050.1.81104 WP_000284050.1.81120 WP_000284050.1.81127 WP_000284050.1.81141 WP_000284050.1.81156 WP_000284050.1.81160 WP_000284050.1.81165 WP_000284050.1.8118 WP_000284050.1.81180 WP_000284050.1.81182 WP_000284050.1.81186 WP_000284050.1.8121 WP_000284050.1.81219 WP_000284050.1.81266 WP_000284050.1.81267 WP_000284050.1.81273 WP_000284050.1.81281 WP_000284050.1.81283 WP_000284050.1.81286 WP_000284050.1.8129 WP_000284050.1.81298 WP_000284050.1.81313 WP_000284050.1.81316 WP_000284050.1.81323 WP_000284050.1.81347 WP_000284050.1.81376 WP_000284050.1.81391 WP_000284050.1.81396 WP_000284050.1.814 WP_000284050.1.81418 WP_000284050.1.81420 WP_000284050.1.81423 WP_000284050.1.81438 WP_000284050.1.81442 WP_000284050.1.81469 WP_000284050.1.81475 WP_000284050.1.81484 WP_000284050.1.81514 WP_000284050.1.81517 WP_000284050.1.8156 WP_000284050.1.81576 WP_000284050.1.81577 WP_000284050.1.81582 WP_000284050.1.81588 WP_000284050.1.81589 WP_000284050.1.81596 WP_000284050.1.81602 WP_000284050.1.81625 WP_000284050.1.81688 WP_000284050.1.81692 WP_000284050.1.81715 WP_000284050.1.8172 WP_000284050.1.81723 WP_000284050.1.81754 WP_000284050.1.81761 WP_000284050.1.81819 WP_000284050.1.81821 WP_000284050.1.8183 WP_000284050.1.81832 WP_000284050.1.81843 WP_000284050.1.81869 WP_000284050.1.81873 WP_000284050.1.81876 WP_000284050.1.81881 WP_000284050.1.81888 WP_000284050.1.81934 WP_000284050.1.81935 WP_000284050.1.81939 WP_000284050.1.81952 WP_000284050.1.81956 WP_000284050.1.81972 WP_000284050.1.81975 WP_000284050.1.82 WP_000284050.1.82008 WP_000284050.1.82010 WP_000284050.1.82032 WP_000284050.1.82057 WP_000284050.1.82059 WP_000284050.1.82061 WP_000284050.1.82062 WP_000284050.1.82074 WP_000284050.1.82104 WP_000284050.1.82106 WP_000284050.1.82116 WP_000284050.1.82123 WP_000284050.1.82137 WP_000284050.1.82166 WP_000284050.1.82217 WP_000284050.1.82221 WP_000284050.1.82239 WP_000284050.1.82240 WP_000284050.1.82242 WP_000284050.1.82246 WP_000284050.1.82275 WP_000284050.1.82280 WP_000284050.1.82296 WP_000284050.1.82316 WP_000284050.1.82320 WP_000284050.1.82326 WP_000284050.1.82330 WP_000284050.1.8235 WP_000284050.1.82378 WP_000284050.1.82438 WP_000284050.1.82439 WP_000284050.1.82485 WP_000284050.1.82499 WP_000284050.1.82507 WP_000284050.1.82514 WP_000284050.1.82527 WP_000284050.1.82536 WP_000284050.1.82539 WP_000284050.1.8255 WP_000284050.1.82572 WP_000284050.1.82589 WP_000284050.1.82594 WP_000284050.1.82614 WP_000284050.1.82626 WP_000284050.1.82629 WP_000284050.1.82647 WP_000284050.1.82661 WP_000284050.1.8268 WP_000284050.1.82682 WP_000284050.1.82691 WP_000284050.1.82698 WP_000284050.1.82700 WP_000284050.1.82705 WP_000284050.1.82711 WP_000284050.1.82715 WP_000284050.1.82718 WP_000284050.1.82747 WP_000284050.1.82754 WP_000284050.1.8277 WP_000284050.1.82776 WP_000284050.1.82780 WP_000284050.1.82797 WP_000284050.1.82799 WP_000284050.1.82808 WP_000284050.1.82816 WP_000284050.1.82820 WP_000284050.1.82831 WP_000284050.1.82833 WP_000284050.1.82853 WP_000284050.1.82902 WP_000284050.1.82923 WP_000284050.1.82991 WP_000284050.1.83020 WP_000284050.1.83033 WP_000284050.1.83035 WP_000284050.1.83036 WP_000284050.1.83051 WP_000284050.1.83059 WP_000284050.1.8306 WP_000284050.1.8308 WP_000284050.1.83093 WP_000284050.1.83097 WP_000284050.1.83099 WP_000284050.1.831 WP_000284050.1.83118 WP_000284050.1.83125 WP_000284050.1.83127 WP_000284050.1.83140 WP_000284050.1.83144 WP_000284050.1.83151 WP_000284050.1.83160 WP_000284050.1.83177 WP_000284050.1.83205 WP_000284050.1.83214 WP_000284050.1.83218 WP_000284050.1.83224 WP_000284050.1.83253 WP_000284050.1.83256 WP_000284050.1.83286 WP_000284050.1.83313 WP_000284050.1.83321 WP_000284050.1.83330 WP_000284050.1.83340 WP_000284050.1.83347 WP_000284050.1.83375 WP_000284050.1.83384 WP_000284050.1.83393 WP_000284050.1.83415 WP_000284050.1.8345 WP_000284050.1.83466 WP_000284050.1.83481 WP_000284050.1.83506 WP_000284050.1.83537 WP_000284050.1.83544 WP_000284050.1.83564 WP_000284050.1.83582 WP_000284050.1.83584 WP_000284050.1.83644 WP_000284050.1.83660 WP_000284050.1.83668 WP_000284050.1.8368 WP_000284050.1.83684 WP_000284050.1.83706 WP_000284050.1.83712 WP_000284050.1.83735 WP_000284050.1.83762 WP_000284050.1.83781 WP_000284050.1.83807 WP_000284050.1.83820 WP_000284050.1.8384 WP_000284050.1.8386 WP_000284050.1.83879 WP_000284050.1.83911 WP_000284050.1.83936 WP_000284050.1.83941 WP_000284050.1.84004 WP_000284050.1.84014 WP_000284050.1.84021 WP_000284050.1.8405 WP_000284050.1.84059 WP_000284050.1.84060 WP_000284050.1.84074 WP_000284050.1.8411 WP_000284050.1.84140 WP_000284050.1.84164 WP_000284050.1.84172 WP_000284050.1.84185 WP_000284050.1.84197 WP_000284050.1.84210 WP_000284050.1.84215 WP_000284050.1.84219 WP_000284050.1.84264 WP_000284050.1.84298 WP_000284050.1.84312 WP_000284050.1.84313 WP_000284050.1.84316 WP_000284050.1.84319 WP_000284050.1.84326 WP_000284050.1.84331 WP_000284050.1.84339 WP_000284050.1.84348 WP_000284050.1.84402 WP_000284050.1.84405 WP_000284050.1.84410 WP_000284050.1.84436 WP_000284050.1.8444 WP_000284050.1.84462 WP_000284050.1.84464 WP_000284050.1.84467 WP_000284050.1.8447 WP_000284050.1.84473 WP_000284050.1.84476 WP_000284050.1.84482 WP_000284050.1.84484 WP_000284050.1.84486 WP_000284050.1.84511 WP_000284050.1.84518 WP_000284050.1.84531 WP_000284050.1.84534 WP_000284050.1.84584 WP_000284050.1.84635 WP_000284050.1.84639 WP_000284050.1.84656 WP_000284050.1.84657 WP_000284050.1.84668 WP_000284050.1.84675 WP_000284050.1.84697 WP_000284050.1.8470 WP_000284050.1.84731 WP_000284050.1.84738 WP_000284050.1.84740 WP_000284050.1.84768 WP_000284050.1.8477 WP_000284050.1.84797 WP_000284050.1.84841 WP_000284050.1.84850 WP_000284050.1.84875 WP_000284050.1.84877 WP_000284050.1.84878 WP_000284050.1.84881 WP_000284050.1.84893 WP_000284050.1.84894 WP_000284050.1.84916 WP_000284050.1.84929 WP_000284050.1.84941 WP_000284050.1.84948 WP_000284050.1.84966 WP_000284050.1.84972 WP_000284050.1.84986 WP_000284050.1.84989 WP_000284050.1.84990 WP_000284050.1.84994 WP_000284050.1.85002 WP_000284050.1.85008 WP_000284050.1.85011 WP_000284050.1.85025 WP_000284050.1.85048 WP_000284050.1.85052 WP_000284050.1.85077 WP_000284050.1.85085 WP_000284050.1.85090 WP_000284050.1.85098 WP_000284050.1.85105 WP_000284050.1.85106 WP_000284050.1.85112 WP_000284050.1.85125 WP_000284050.1.85129 WP_000284050.1.85138 WP_000284050.1.85141 WP_000284050.1.85155 WP_000284050.1.85156 WP_000284050.1.85175 WP_000284050.1.85188 WP_000284050.1.85216 WP_000284050.1.85241 WP_000284050.1.85247 WP_000284050.1.85252 WP_000284050.1.85253 WP_000284050.1.85255 WP_000284050.1.85260 WP_000284050.1.8530 WP_000284050.1.85305 WP_000284050.1.85310 WP_000284050.1.85315 WP_000284050.1.85320 WP_000284050.1.85323 WP_000284050.1.85329 WP_000284050.1.85335 WP_000284050.1.85342 WP_000284050.1.85361 WP_000284050.1.85369 WP_000284050.1.85384 WP_000284050.1.85385 WP_000284050.1.85416 WP_000284050.1.85435 WP_000284050.1.85500 WP_000284050.1.85504 WP_000284050.1.85525 WP_000284050.1.85546 WP_000284050.1.85554 WP_000284050.1.85556 WP_000284050.1.85558 WP_000284050.1.85563 WP_000284050.1.85578 WP_000284050.1.85593 WP_000284050.1.8560 WP_000284050.1.85601 WP_000284050.1.85623 WP_000284050.1.8564 WP_000284050.1.85657 WP_000284050.1.85685 WP_000284050.1.85722 WP_000284050.1.85752 WP_000284050.1.85762 WP_000284050.1.85767 WP_000284050.1.85772 WP_000284050.1.85773 WP_000284050.1.85781 WP_000284050.1.8579 WP_000284050.1.85793 WP_000284050.1.85800 WP_000284050.1.85806 WP_000284050.1.85857 WP_000284050.1.85895 WP_000284050.1.85939 WP_000284050.1.85944 WP_000284050.1.85948 WP_000284050.1.85969 WP_000284050.1.86 WP_000284050.1.86016 WP_000284050.1.8603 WP_000284050.1.86035 WP_000284050.1.86063 WP_000284050.1.8607 WP_000284050.1.86104 WP_000284050.1.86105 WP_000284050.1.86110 WP_000284050.1.86145 WP_000284050.1.86149 WP_000284050.1.86161 WP_000284050.1.86166 WP_000284050.1.86171 WP_000284050.1.86176 WP_000284050.1.86179 WP_000284050.1.86189 WP_000284050.1.86196 WP_000284050.1.8621 WP_000284050.1.86210 WP_000284050.1.86225 WP_000284050.1.86227 WP_000284050.1.86228 WP_000284050.1.86234 WP_000284050.1.86255 WP_000284050.1.86261 WP_000284050.1.86263 WP_000284050.1.86266 WP_000284050.1.86273 WP_000284050.1.86280 WP_000284050.1.86283 WP_000284050.1.86307 WP_000284050.1.86340 WP_000284050.1.8635 WP_000284050.1.86353 WP_000284050.1.86355 WP_000284050.1.86364 WP_000284050.1.86371 WP_000284050.1.86376 WP_000284050.1.86393 WP_000284050.1.86411 WP_000284050.1.86412 WP_000284050.1.86437 WP_000284050.1.86451 WP_000284050.1.86452 WP_000284050.1.86454 WP_000284050.1.86461 WP_000284050.1.86475 WP_000284050.1.86483 WP_000284050.1.86492 WP_000284050.1.86518 WP_000284050.1.8652 WP_000284050.1.8656 WP_000284050.1.86560 WP_000284050.1.86574 WP_000284050.1.86583 WP_000284050.1.86586 WP_000284050.1.86598 WP_000284050.1.86609 WP_000284050.1.86613 WP_000284050.1.86617 WP_000284050.1.86627 WP_000284050.1.86640 WP_000284050.1.86667 WP_000284050.1.86673 WP_000284050.1.86674 WP_000284050.1.86681 WP_000284050.1.86691 WP_000284050.1.86707 WP_000284050.1.86717 WP_000284050.1.86727 WP_000284050.1.86734 WP_000284050.1.86760 WP_000284050.1.86787 WP_000284050.1.86788 WP_000284050.1.8679 WP_000284050.1.86833 WP_000284050.1.86846 WP_000284050.1.86848 WP_000284050.1.8687 WP_000284050.1.86935 WP_000284050.1.86956 WP_000284050.1.86959 WP_000284050.1.86975 WP_000284050.1.86994 WP_000284050.1.87043 WP_000284050.1.8705 WP_000284050.1.87059 WP_000284050.1.87067 WP_000284050.1.87074 WP_000284050.1.87075 WP_000284050.1.87076 WP_000284050.1.87102 WP_000284050.1.87109 WP_000284050.1.8711 WP_000284050.1.87147 WP_000284050.1.87177 WP_000284050.1.87189 WP_000284050.1.87247 WP_000284050.1.87249 WP_000284050.1.87254 WP_000284050.1.87310 WP_000284050.1.87339 WP_000284050.1.87358 WP_000284050.1.87371 WP_000284050.1.87382 WP_000284050.1.87389 WP_000284050.1.87400 WP_000284050.1.87410 WP_000284050.1.87443 WP_000284050.1.87465 WP_000284050.1.87504 WP_000284050.1.87557 WP_000284050.1.87563 WP_000284050.1.87568 WP_000284050.1.87574 WP_000284050.1.87581 WP_000284050.1.87590 WP_000284050.1.87607 WP_000284050.1.87608 WP_000284050.1.87610 WP_000284050.1.87616 WP_000284050.1.87633 WP_000284050.1.87635 WP_000284050.1.87639 WP_000284050.1.87655 WP_000284050.1.87675 WP_000284050.1.87694 WP_000284050.1.87696 WP_000284050.1.8771 WP_000284050.1.87721 WP_000284050.1.87726 WP_000284050.1.87728 WP_000284050.1.87733 WP_000284050.1.87738 WP_000284050.1.87766 WP_000284050.1.8778 WP_000284050.1.87786 WP_000284050.1.87788 WP_000284050.1.87789 WP_000284050.1.87822 WP_000284050.1.87834 WP_000284050.1.87857 WP_000284050.1.87883 WP_000284050.1.87914 WP_000284050.1.87919 WP_000284050.1.87973 WP_000284050.1.87976 WP_000284050.1.87980 WP_000284050.1.87984 WP_000284050.1.87989 WP_000284050.1.87990 WP_000284050.1.880 WP_000284050.1.88017 WP_000284050.1.88020 WP_000284050.1.88066 WP_000284050.1.8807 WP_000284050.1.88082 WP_000284050.1.88088 WP_000284050.1.88110 WP_000284050.1.88119 WP_000284050.1.88149 WP_000284050.1.88155 WP_000284050.1.88189 WP_000284050.1.88197 WP_000284050.1.8822 WP_000284050.1.88234 WP_000284050.1.88238 WP_000284050.1.88260 WP_000284050.1.88263 WP_000284050.1.88285 WP_000284050.1.88301 WP_000284050.1.88304 WP_000284050.1.88336 WP_000284050.1.88352 WP_000284050.1.88376 WP_000284050.1.88379 WP_000284050.1.88384 WP_000284050.1.88413 WP_000284050.1.88427 WP_000284050.1.8843 WP_000284050.1.88434 WP_000284050.1.88438 WP_000284050.1.88462 WP_000284050.1.8848 WP_000284050.1.88499 WP_000284050.1.88524 WP_000284050.1.88527 WP_000284050.1.88528 WP_000284050.1.88535 WP_000284050.1.88539 WP_000284050.1.8854 WP_000284050.1.8855 WP_000284050.1.88557 WP_000284050.1.88562 WP_000284050.1.88577 WP_000284050.1.88598 WP_000284050.1.88603 WP_000284050.1.88607 WP_000284050.1.88631 WP_000284050.1.88646 WP_000284050.1.88667 WP_000284050.1.88678 WP_000284050.1.88685 WP_000284050.1.88686 WP_000284050.1.88709 WP_000284050.1.88710 WP_000284050.1.88711 WP_000284050.1.88717 WP_000284050.1.88720 WP_000284050.1.88729 WP_000284050.1.88732 WP_000284050.1.88735 WP_000284050.1.88752 WP_000284050.1.88757 WP_000284050.1.88767 WP_000284050.1.8879 WP_000284050.1.88793 WP_000284050.1.88803 WP_000284050.1.88826 WP_000284050.1.88834 WP_000284050.1.88864 WP_000284050.1.88880 WP_000284050.1.88883 WP_000284050.1.88891 WP_000284050.1.88941 WP_000284050.1.88950 WP_000284050.1.88953 WP_000284050.1.88961 WP_000284050.1.88997 WP_000284050.1.89018 WP_000284050.1.89043 WP_000284050.1.89050 WP_000284050.1.8906 WP_000284050.1.89067 WP_000284050.1.89090 WP_000284050.1.89097 WP_000284050.1.89099 WP_000284050.1.89111 WP_000284050.1.89150 WP_000284050.1.89163 WP_000284050.1.89165 WP_000284050.1.89183 WP_000284050.1.89197 WP_000284050.1.89200 WP_000284050.1.89203 WP_000284050.1.89214 WP_000284050.1.89217 WP_000284050.1.89255 WP_000284050.1.8928 WP_000284050.1.89285 WP_000284050.1.89305 WP_000284050.1.89312 WP_000284050.1.89322 WP_000284050.1.89334 WP_000284050.1.89335 WP_000284050.1.89351 WP_000284050.1.89379 WP_000284050.1.8938 WP_000284050.1.89385 WP_000284050.1.89396 WP_000284050.1.894 WP_000284050.1.89400 WP_000284050.1.89403 WP_000284050.1.89405 WP_000284050.1.89416 WP_000284050.1.89427 WP_000284050.1.89432 WP_000284050.1.8945 WP_000284050.1.89455 WP_000284050.1.89458 WP_000284050.1.89466 WP_000284050.1.89468 WP_000284050.1.89469 WP_000284050.1.89474 WP_000284050.1.89479 WP_000284050.1.89492 WP_000284050.1.89510 WP_000284050.1.89551 WP_000284050.1.89569 WP_000284050.1.89583 WP_000284050.1.89601 WP_000284050.1.89605 WP_000284050.1.89627 WP_000284050.1.89630 WP_000284050.1.89646 WP_000284050.1.89656 WP_000284050.1.89674 WP_000284050.1.89679 WP_000284050.1.89700 WP_000284050.1.89710 WP_000284050.1.89745 WP_000284050.1.89768 WP_000284050.1.89781 WP_000284050.1.89788 WP_000284050.1.89818 WP_000284050.1.89839 WP_000284050.1.89841 WP_000284050.1.8985 WP_000284050.1.89852 WP_000284050.1.89879 WP_000284050.1.89895 WP_000284050.1.89899 WP_000284050.1.89915 WP_000284050.1.89917 WP_000284050.1.89918 WP_000284050.1.89920 WP_000284050.1.89925 WP_000284050.1.89927 WP_000284050.1.89959 WP_000284050.1.89977 WP_000284050.1.89988 WP_000284050.1.89998 WP_000284050.1.90017 WP_000284050.1.90022 WP_000284050.1.90050 WP_000284050.1.90063 WP_000284050.1.90065 WP_000284050.1.90078 WP_000284050.1.9009 WP_000284050.1.9010 WP_000284050.1.90115 WP_000284050.1.90128 WP_000284050.1.90139 WP_000284050.1.90146 WP_000284050.1.90168 WP_000284050.1.90171 WP_000284050.1.90182 WP_000284050.1.902 WP_000284050.1.90205 WP_000284050.1.90219 WP_000284050.1.90249 WP_000284050.1.90256 WP_000284050.1.90257 WP_000284050.1.90266 WP_000284050.1.90270 WP_000284050.1.90314 WP_000284050.1.90315 WP_000284050.1.90332 WP_000284050.1.90342 WP_000284050.1.90346 WP_000284050.1.90349 WP_000284050.1.90357 WP_000284050.1.90358 WP_000284050.1.9036 WP_000284050.1.9037 WP_000284050.1.90389 WP_000284050.1.90405 WP_000284050.1.90435 WP_000284050.1.90436 WP_000284050.1.90441 WP_000284050.1.90449 WP_000284050.1.90467 WP_000284050.1.90511 WP_000284050.1.90525 WP_000284050.1.90536 WP_000284050.1.90542 WP_000284050.1.90547 WP_000284050.1.9059 WP_000284050.1.90591 WP_000284050.1.90602 WP_000284050.1.9061 WP_000284050.1.90626 WP_000284050.1.90690 WP_000284050.1.90706 WP_000284050.1.90758 WP_000284050.1.90775 WP_000284050.1.90799 WP_000284050.1.9081 WP_000284050.1.90813 WP_000284050.1.90822 WP_000284050.1.90828 WP_000284050.1.90834 WP_000284050.1.90837 WP_000284050.1.90839 WP_000284050.1.9084 WP_000284050.1.90842 WP_000284050.1.90844 WP_000284050.1.90848 WP_000284050.1.90856 WP_000284050.1.90864 WP_000284050.1.90865 WP_000284050.1.9087 WP_000284050.1.90873 WP_000284050.1.90890 WP_000284050.1.909 WP_000284050.1.90905 WP_000284050.1.90924 WP_000284050.1.90951 WP_000284050.1.90960 WP_000284050.1.90967 WP_000284050.1.90979 WP_000284050.1.9098 WP_000284050.1.90988 WP_000284050.1.90996 WP_000284050.1.90997 WP_000284050.1.91 WP_000284050.1.91007 WP_000284050.1.91010 WP_000284050.1.91018 WP_000284050.1.91072 WP_000284050.1.91088 WP_000284050.1.91094 WP_000284050.1.91113 WP_000284050.1.91117 WP_000284050.1.91121 WP_000284050.1.91138 WP_000284050.1.91143 WP_000284050.1.91153 WP_000284050.1.91170 WP_000284050.1.9118 WP_000284050.1.91182 WP_000284050.1.9119 WP_000284050.1.91213 WP_000284050.1.91220 WP_000284050.1.91266 WP_000284050.1.91268 WP_000284050.1.91277 WP_000284050.1.91288 WP_000284050.1.91290 WP_000284050.1.91340 WP_000284050.1.91341 WP_000284050.1.91354 WP_000284050.1.91356 WP_000284050.1.91361 WP_000284050.1.91377 WP_000284050.1.91384 WP_000284050.1.91397 WP_000284050.1.91414 WP_000284050.1.91425 WP_000284050.1.91445 WP_000284050.1.91462 WP_000284050.1.91482 WP_000284050.1.91485 WP_000284050.1.91494 WP_000284050.1.915 WP_000284050.1.91511 WP_000284050.1.91515 WP_000284050.1.91526 WP_000284050.1.91543 WP_000284050.1.91548 WP_000284050.1.91549 WP_000284050.1.91551 WP_000284050.1.91565 WP_000284050.1.91566 WP_000284050.1.9157 WP_000284050.1.91594 WP_000284050.1.91596 WP_000284050.1.9160 WP_000284050.1.91626 WP_000284050.1.91630 WP_000284050.1.91640 WP_000284050.1.91643 WP_000284050.1.91644 WP_000284050.1.91651 WP_000284050.1.91666 WP_000284050.1.91672 WP_000284050.1.9168 WP_000284050.1.91685 WP_000284050.1.9169 WP_000284050.1.91701 WP_000284050.1.9171 WP_000284050.1.91739 WP_000284050.1.91756 WP_000284050.1.91777 WP_000284050.1.91779 WP_000284050.1.91782 WP_000284050.1.91787 WP_000284050.1.91793 WP_000284050.1.91801 WP_000284050.1.91814 WP_000284050.1.91843 WP_000284050.1.9185 WP_000284050.1.91850 WP_000284050.1.91863 WP_000284050.1.91871 WP_000284050.1.91879 WP_000284050.1.91887 WP_000284050.1.91893 WP_000284050.1.91894 WP_000284050.1.91951 WP_000284050.1.91954 WP_000284050.1.91959 WP_000284050.1.91965 WP_000284050.1.91971 WP_000284050.1.9199 WP_000284050.1.91994 WP_000284050.1.92005 WP_000284050.1.92014 WP_000284050.1.92019 WP_000284050.1.92025 WP_000284050.1.92029 WP_000284050.1.92031 WP_000284050.1.92048 WP_000284050.1.92053 WP_000284050.1.92058 WP_000284050.1.9209 WP_000284050.1.92096 WP_000284050.1.921 WP_000284050.1.92102 WP_000284050.1.92114 WP_000284050.1.92123 WP_000284050.1.9215 WP_000284050.1.92161 WP_000284050.1.92163 WP_000284050.1.92180 WP_000284050.1.92195 WP_000284050.1.92201 WP_000284050.1.92215 WP_000284050.1.92224 WP_000284050.1.92276 WP_000284050.1.92295 WP_000284050.1.92304 WP_000284050.1.92305 WP_000284050.1.92311 WP_000284050.1.92323 WP_000284050.1.92361 WP_000284050.1.92384 WP_000284050.1.924 WP_000284050.1.92403 WP_000284050.1.92434 WP_000284050.1.92462 WP_000284050.1.92473 WP_000284050.1.92495 WP_000284050.1.92496 WP_000284050.1.92506 WP_000284050.1.92532 WP_000284050.1.92535 WP_000284050.1.9255 WP_000284050.1.92568 WP_000284050.1.92571 WP_000284050.1.92577 WP_000284050.1.92614 WP_000284050.1.92615 WP_000284050.1.92634 WP_000284050.1.92638 WP_000284050.1.9264 WP_000284050.1.92648 WP_000284050.1.9266 WP_000284050.1.92668 WP_000284050.1.92693 WP_000284050.1.92708 WP_000284050.1.92719 WP_000284050.1.92742 WP_000284050.1.92750 WP_000284050.1.92767 WP_000284050.1.92780 WP_000284050.1.92781 WP_000284050.1.92792 WP_000284050.1.92793 WP_000284050.1.92796 WP_000284050.1.92819 WP_000284050.1.92845 WP_000284050.1.92865 WP_000284050.1.92882 WP_000284050.1.92886 WP_000284050.1.92932 WP_000284050.1.92943 WP_000284050.1.92953 WP_000284050.1.92989 WP_000284050.1.92991 WP_000284050.1.93005 WP_000284050.1.93016 WP_000284050.1.93017 WP_000284050.1.93019 WP_000284050.1.93023 WP_000284050.1.93027 WP_000284050.1.93033 WP_000284050.1.93048 WP_000284050.1.93052 WP_000284050.1.93054 WP_000284050.1.93069 WP_000284050.1.93072 WP_000284050.1.93085 WP_000284050.1.93100 WP_000284050.1.93112 WP_000284050.1.93133 WP_000284050.1.93138 WP_000284050.1.93139 WP_000284050.1.93150 WP_000284050.1.93167 WP_000284050.1.93175 WP_000284050.1.93233 WP_000284050.1.93252 WP_000284050.1.93267 WP_000284050.1.9327 WP_000284050.1.93276 WP_000284050.1.93291 WP_000284050.1.93309 WP_000284050.1.9331 WP_000284050.1.93312 WP_000284050.1.93326 WP_000284050.1.93338 WP_000284050.1.93379 WP_000284050.1.93388 WP_000284050.1.934 WP_000284050.1.93427 WP_000284050.1.93428 WP_000284050.1.93431 WP_000284050.1.93453 WP_000284050.1.93461 WP_000284050.1.93463 WP_000284050.1.93464 WP_000284050.1.93468 WP_000284050.1.93509 WP_000284050.1.93531 WP_000284050.1.93533 WP_000284050.1.93552 WP_000284050.1.9356 WP_000284050.1.93569 WP_000284050.1.93601 WP_000284050.1.93605 WP_000284050.1.93621 WP_000284050.1.93626 WP_000284050.1.93629 WP_000284050.1.93630 WP_000284050.1.93634 WP_000284050.1.93637 WP_000284050.1.93639 WP_000284050.1.93652 WP_000284050.1.93665 WP_000284050.1.93670 WP_000284050.1.93673 WP_000284050.1.93679 WP_000284050.1.93694 WP_000284050.1.93695 WP_000284050.1.93716 WP_000284050.1.93733 WP_000284050.1.93737 WP_000284050.1.93742 WP_000284050.1.93743 WP_000284050.1.93745 WP_000284050.1.93755 WP_000284050.1.93765 WP_000284050.1.93768 WP_000284050.1.938 WP_000284050.1.93800 WP_000284050.1.93821 WP_000284050.1.93870 WP_000284050.1.93873 WP_000284050.1.93877 WP_000284050.1.939 WP_000284050.1.93900 WP_000284050.1.93911 WP_000284050.1.93918 WP_000284050.1.93921 WP_000284050.1.93922 WP_000284050.1.93951 WP_000284050.1.93952 WP_000284050.1.93971 WP_000284050.1.94008 WP_000284050.1.94011 WP_000284050.1.94028 WP_000284050.1.94035 WP_000284050.1.94040 WP_000284050.1.94057 WP_000284050.1.94069 WP_000284050.1.94156 WP_000284050.1.9416 WP_000284050.1.94176 WP_000284050.1.94190 WP_000284050.1.9420 WP_000284050.1.94213 WP_000284050.1.94232 WP_000284050.1.9426 WP_000284050.1.94271 WP_000284050.1.94282 WP_000284050.1.94298 WP_000284050.1.94302 WP_000284050.1.94317 WP_000284050.1.94343 WP_000284050.1.94353 WP_000284050.1.94388 WP_000284050.1.94404 WP_000284050.1.94417 WP_000284050.1.94429 WP_000284050.1.94430 WP_000284050.1.94438 WP_000284050.1.94446 WP_000284050.1.94468 WP_000284050.1.94475 WP_000284050.1.94497 WP_000284050.1.94507 WP_000284050.1.94516 WP_000284050.1.94523 WP_000284050.1.94542 WP_000284050.1.94544 WP_000284050.1.94548 WP_000284050.1.9457 WP_000284050.1.94578 WP_000284050.1.94580 WP_000284050.1.94589 WP_000284050.1.94619 WP_000284050.1.94626 WP_000284050.1.94646 WP_000284050.1.94676 WP_000284050.1.94686 WP_000284050.1.94690 WP_000284050.1.94692 WP_000284050.1.94704 WP_000284050.1.94738 WP_000284050.1.94739 WP_000284050.1.9474 WP_000284050.1.94753 WP_000284050.1.94754 WP_000284050.1.94764 WP_000284050.1.94787 WP_000284050.1.94790 WP_000284050.1.948 WP_000284050.1.94801 WP_000284050.1.94806 WP_000284050.1.94808 WP_000284050.1.94822 WP_000284050.1.94823 WP_000284050.1.94836 WP_000284050.1.94841 WP_000284050.1.94847 WP_000284050.1.94869 WP_000284050.1.94877 WP_000284050.1.94880 WP_000284050.1.94889 WP_000284050.1.9489 WP_000284050.1.94892 WP_000284050.1.94898 WP_000284050.1.949 WP_000284050.1.94903 WP_000284050.1.94907 WP_000284050.1.9491 WP_000284050.1.94927 WP_000284050.1.94934 WP_000284050.1.94935 WP_000284050.1.94938 WP_000284050.1.94949 WP_000284050.1.94955 WP_000284050.1.94963 WP_000284050.1.94991 WP_000284050.1.94993 WP_000284050.1.94997 WP_000284050.1.95005 WP_000284050.1.95011 WP_000284050.1.95022 WP_000284050.1.95028 WP_000284050.1.95035 WP_000284050.1.95036 WP_000284050.1.95037 WP_000284050.1.95062 WP_000284050.1.95080 WP_000284050.1.95084 WP_000284050.1.95105 WP_000284050.1.95129 WP_000284050.1.9513 WP_000284050.1.95161 WP_000284050.1.95198 WP_000284050.1.95233 WP_000284050.1.95243 WP_000284050.1.95244 WP_000284050.1.95254 WP_000284050.1.95275 WP_000284050.1.95310 WP_000284050.1.95329 WP_000284050.1.95364 WP_000284050.1.95366 WP_000284050.1.95368 WP_000284050.1.95378 WP_000284050.1.95381 WP_000284050.1.95390 WP_000284050.1.95395 WP_000284050.1.95398 WP_000284050.1.95400 WP_000284050.1.95403 WP_000284050.1.95424 WP_000284050.1.95428 WP_000284050.1.95431 WP_000284050.1.95438 WP_000284050.1.95449 WP_000284050.1.95490 WP_000284050.1.95518 WP_000284050.1.95521 WP_000284050.1.95563 WP_000284050.1.9559 WP_000284050.1.95595 WP_000284050.1.95596 WP_000284050.1.95604 WP_000284050.1.95611 WP_000284050.1.95628 WP_000284050.1.95634 WP_000284050.1.95655 WP_000284050.1.9566 WP_000284050.1.95666 WP_000284050.1.95680 WP_000284050.1.95712 WP_000284050.1.95756 WP_000284050.1.95759 WP_000284050.1.95771 WP_000284050.1.95783 WP_000284050.1.95784 WP_000284050.1.95800 WP_000284050.1.95801 WP_000284050.1.95821 WP_000284050.1.95824 WP_000284050.1.95827 WP_000284050.1.95834 WP_000284050.1.95835 WP_000284050.1.95846 WP_000284050.1.95849 WP_000284050.1.95858 WP_000284050.1.95865 WP_000284050.1.95916 WP_000284050.1.95929 WP_000284050.1.95931 WP_000284050.1.95932 WP_000284050.1.95951 WP_000284050.1.960 WP_000284050.1.96015 WP_000284050.1.96032 WP_000284050.1.96053 WP_000284050.1.96059 WP_000284050.1.96066 WP_000284050.1.96086 WP_000284050.1.96097 WP_000284050.1.96110 WP_000284050.1.96114 WP_000284050.1.96128 WP_000284050.1.96145 WP_000284050.1.9616 WP_000284050.1.96177 WP_000284050.1.96215 WP_000284050.1.96222 WP_000284050.1.96223 WP_000284050.1.96229 WP_000284050.1.96247 WP_000284050.1.96253 WP_000284050.1.96263 WP_000284050.1.96278 WP_000284050.1.96279 WP_000284050.1.96281 WP_000284050.1.96290 WP_000284050.1.96293 WP_000284050.1.96299 WP_000284050.1.96303 WP_000284050.1.9631 WP_000284050.1.96339 WP_000284050.1.96341 WP_000284050.1.96378 WP_000284050.1.96392 WP_000284050.1.96394 WP_000284050.1.9641 WP_000284050.1.96417 WP_000284050.1.96420 WP_000284050.1.96425 WP_000284050.1.96450 WP_000284050.1.96457 WP_000284050.1.96478 WP_000284050.1.96479 WP_000284050.1.96480 WP_000284050.1.96484 WP_000284050.1.9649 WP_000284050.1.96494 WP_000284050.1.965 WP_000284050.1.96519 WP_000284050.1.96541 WP_000284050.1.96558 WP_000284050.1.96562 WP_000284050.1.9657 WP_000284050.1.96585 WP_000284050.1.96608 WP_000284050.1.96609 WP_000284050.1.9661 WP_000284050.1.96617 WP_000284050.1.96633 WP_000284050.1.96659 WP_000284050.1.96676 WP_000284050.1.9668 WP_000284050.1.96680 WP_000284050.1.96683 WP_000284050.1.96701 WP_000284050.1.9671 WP_000284050.1.96725 WP_000284050.1.96743 WP_000284050.1.96753 WP_000284050.1.96759 WP_000284050.1.96762 WP_000284050.1.96769 WP_000284050.1.96779 WP_000284050.1.96796 WP_000284050.1.96797 WP_000284050.1.96817 WP_000284050.1.9682 WP_000284050.1.96820 WP_000284050.1.96850 WP_000284050.1.96864 WP_000284050.1.96894 WP_000284050.1.9690 WP_000284050.1.9691 WP_000284050.1.96924 WP_000284050.1.96932 WP_000284050.1.96936 WP_000284050.1.96944 WP_000284050.1.96971 WP_000284050.1.96984 WP_000284050.1.96989 WP_000284050.1.97011 WP_000284050.1.97027 WP_000284050.1.97049 WP_000284050.1.97059 WP_000284050.1.9708 WP_000284050.1.97119 WP_000284050.1.97123 WP_000284050.1.97147 WP_000284050.1.97170 WP_000284050.1.97193 WP_000284050.1.97195 WP_000284050.1.97200 WP_000284050.1.97226 WP_000284050.1.97231 WP_000284050.1.97238 WP_000284050.1.97248 WP_000284050.1.97279 WP_000284050.1.97282 WP_000284050.1.9729 WP_000284050.1.97292 WP_000284050.1.97344 WP_000284050.1.97351 WP_000284050.1.97356 WP_000284050.1.97360 WP_000284050.1.97361 WP_000284050.1.97379 WP_000284050.1.97387 WP_000284050.1.9740 WP_000284050.1.97402 WP_000284050.1.97418 WP_000284050.1.97421 WP_000284050.1.97434 WP_000284050.1.97437 WP_000284050.1.97439 WP_000284050.1.97459 WP_000284050.1.97464 WP_000284050.1.9747 WP_000284050.1.97490 WP_000284050.1.97502 WP_000284050.1.97513 WP_000284050.1.97525 WP_000284050.1.97527 WP_000284050.1.97538 WP_000284050.1.97544 WP_000284050.1.97549 WP_000284050.1.97560 WP_000284050.1.97619 WP_000284050.1.97632 WP_000284050.1.97654 WP_000284050.1.97667 WP_000284050.1.97675 WP_000284050.1.97677 WP_000284050.1.97685 WP_000284050.1.9770 WP_000284050.1.97705 WP_000284050.1.97711 WP_000284050.1.97770 WP_000284050.1.97775 WP_000284050.1.97778 WP_000284050.1.97789 WP_000284050.1.97798 WP_000284050.1.978 WP_000284050.1.97802 WP_000284050.1.97815 WP_000284050.1.97822 WP_000284050.1.97823 WP_000284050.1.97825 WP_000284050.1.97871 WP_000284050.1.97890 WP_000284050.1.97895 WP_000284050.1.97919 WP_000284050.1.97930 WP_000284050.1.97932 WP_000284050.1.97937 WP_000284050.1.97962 WP_000284050.1.97982 WP_000284050.1.97996 WP_000284050.1.98000 WP_000284050.1.98005 WP_000284050.1.98012 WP_000284050.1.98026 WP_000284050.1.9803 WP_000284050.1.98046 WP_000284050.1.98082 WP_000284050.1.98083 WP_000284050.1.981 WP_000284050.1.98102 WP_000284050.1.98115 WP_000284050.1.98139 WP_000284050.1.98155 WP_000284050.1.9816 WP_000284050.1.98167 WP_000284050.1.9817 WP_000284050.1.98176 WP_000284050.1.98187 WP_000284050.1.98202 WP_000284050.1.98205 WP_000284050.1.98208 WP_000284050.1.98220 WP_000284050.1.98232 WP_000284050.1.98235 WP_000284050.1.98239 WP_000284050.1.98241 WP_000284050.1.98244 WP_000284050.1.98251 WP_000284050.1.98279 WP_000284050.1.98284 WP_000284050.1.98292 WP_000284050.1.98294 WP_000284050.1.98301 WP_000284050.1.98312 WP_000284050.1.98323 WP_000284050.1.98355 WP_000284050.1.98357 WP_000284050.1.98384 WP_000284050.1.98400 WP_000284050.1.98404 WP_000284050.1.98424 WP_000284050.1.98429 WP_000284050.1.9844 WP_000284050.1.98442 WP_000284050.1.98451 WP_000284050.1.98466 WP_000284050.1.98477 WP_000284050.1.98480 WP_000284050.1.98484 WP_000284050.1.98498 WP_000284050.1.98543 WP_000284050.1.98549 WP_000284050.1.98569 WP_000284050.1.98578 WP_000284050.1.9858 WP_000284050.1.98587 WP_000284050.1.98603 WP_000284050.1.98614 WP_000284050.1.98626 WP_000284050.1.98628 WP_000284050.1.98633 WP_000284050.1.9864 WP_000284050.1.98641 WP_000284050.1.98654 WP_000284050.1.98665 WP_000284050.1.98668 WP_000284050.1.98683 WP_000284050.1.98702 WP_000284050.1.98727 WP_000284050.1.98757 WP_000284050.1.98775 WP_000284050.1.98776 WP_000284050.1.98784 WP_000284050.1.98795 WP_000284050.1.9883 WP_000284050.1.98849 WP_000284050.1.98875 WP_000284050.1.98886 WP_000284050.1.98908 WP_000284050.1.98920 WP_000284050.1.98976 WP_000284050.1.98988 WP_000284050.1.99006 WP_000284050.1.99029 WP_000284050.1.99046 WP_000284050.1.99053 WP_000284050.1.99060 WP_000284050.1.9907 WP_000284050.1.99101 WP_000284050.1.99110 WP_000284050.1.99119 WP_000284050.1.99168 WP_000284050.1.99182 WP_000284050.1.99209 WP_000284050.1.99234 WP_000284050.1.99246 WP_000284050.1.99265 WP_000284050.1.99289 WP_000284050.1.99292 WP_000284050.1.99295 WP_000284050.1.9930 WP_000284050.1.99302 WP_000284050.1.99304 WP_000284050.1.99306 WP_000284050.1.99307 WP_000284050.1.99310 WP_000284050.1.99319 WP_000284050.1.99334 WP_000284050.1.99345 WP_000284050.1.9935 WP_000284050.1.99361 WP_000284050.1.99366 WP_000284050.1.99392 WP_000284050.1.9940 WP_000284050.1.99400 WP_000284050.1.99401 WP_000284050.1.99427 WP_000284050.1.99446 WP_000284050.1.99453 WP_000284050.1.99458 WP_000284050.1.99471 WP_000284050.1.99472 WP_000284050.1.99475 WP_000284050.1.99486 WP_000284050.1.99487 WP_000284050.1.99498 WP_000284050.1.9950 WP_000284050.1.99501 WP_000284050.1.99511 WP_000284050.1.99534 WP_000284050.1.99549 WP_000284050.1.99562 WP_000284050.1.99571 WP_000284050.1.99592 WP_000284050.1.99602 WP_000284050.1.99603 WP_000284050.1.99619 WP_000284050.1.99632 WP_000284050.1.99641 WP_000284050.1.99666 WP_000284050.1.99692 WP_000284050.1.99694 WP_000284050.1.99698 WP_000284050.1.99734 WP_000284050.1.99771 WP_000284050.1.99774 WP_000284050.1.99782 WP_000284050.1.99791 WP_000284050.1.99804 WP_000284050.1.99827 WP_000284050.1.99869 WP_000284050.1.99874 WP_000284050.1.99891 WP_000284050.1.99912 WP_000284050.1.99929 WP_000284050.1.99986 YP_002411014.1.14968 YP_006118609.1.29421 YP_006780736.1.12065 gi|387505174|ref|YP_006157430.1| gi|407467696|ref|YP_006785862.1| gi|410484127|ref|YP_006771673.1| gi|544389077|ref|YP_008563387.1| gi|387605716|ref|YP_006094572.1| gi|386605790|ref|YP_006112090.1| gi|82542815|ref|YP_406762.1| gi|387615587|ref|YP_006118609.1| gi|387619984|ref|YP_006127611.1| gi|187730330|ref|YP_001879018.1| gi|218552827|ref|YP_002385740.1| gi|387610718|ref|YP_006113834.1| gi|260842468|ref|YP_003220246.1| APC27252 GMHA_ECOLI gi|386612406|ref|YP_006132072.1| gi|16128208|ref|NP_414757.1| gi|161486313|ref|NP_752309.2| gi|471332438|ref|YP_007555915.1| gi|209397239|ref|YP_002268850.1| gi|110640459|ref|YP_668187.1| gi|443616235|ref|YP_007380091.1| gi|162138492|ref|YP_539296.2| gi|218557180|ref|YP_002390093.1| gi|388476335|ref|YP_488519.1| 155864.Z0280 198214.SF0272 198215.S0293 199310.c0372 300268.SBO_0213 300269.SSON_0264 316385.ECDH10B_0204 316407.lpcA 331111.EcE24377A_0254 331112.EcHS_A0250 344609.SbBS512_E0218 362663.ECP_0252 364106.UTI89_C0262 386585.ECs0249 409438.ECSE_0243 413997.ECB_00217 439855.EcSMS35_0234 444450.ECH74115_0266 469008.ECBD_3400 481805.EcolC_3398 511145.b0222 544404.ECSP_0254 573235.ECO26_0238 585034.ECIAI1_0262 585035.ECS88_0259 585055.EC55989_0246 585056.ECUMN_0243 585395.ECO103_0238 585396.ECO111_0244 585397.ECED1_0256 595496.BWG_0208 gi|407483587|ref|YP_006780736.1| gi|386617720|ref|YP_006137300.1| gi|253774754|ref|YP_003037585.1| gi|218693706|ref|YP_002401373.1| gi|291281066|ref|YP_003497884.1| gi|209917434|ref|YP_002291518.1| gi|238899614|ref|YP_002925410.1| gi|556550441|ref|YP_008720301.1| gi|218688117|ref|YP_002396329.1| gi|387880803|ref|YP_006311105.1| gi|386707968|ref|YP_006171689.1| gi|544574666|ref|YP_008570190.1| gi|56479637|ref|NP_706225.2| gi|378714424|ref|YP_005279317.1| gi|218703495|ref|YP_002411014.1| gi|386597985|ref|YP_006099491.1| gi|157159705|ref|YP_001457023.1| gi|170681190|ref|YP_001742342.1| gi|387828282|ref|YP_003348219.1| gi|386707968|ref|YP_006171689.1| gi|170021390|ref|YP_001726344.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]