SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|253752835|ref|YP_003025975.1| from Streptococcus suis P1/7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|253752835|ref|YP_003025975.1|
Domain Number 1 Region: 14-214
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 3.97e-54
Family PP-loop ATPase 0.00039
Further Details:      
 
Domain Number 2 Region: 342-405
Classification Level Classification E-value
Superfamily PheT/TilS domain 0.0000000418
Family B3/B4 domain of PheRS, PheT 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|253752835|ref|YP_003025975.1|
Sequence length 422
Comment PP-loop family protein [Streptococcus suis P1/7]
Sequence
MKDRFLKVTLDGHFFDKHKKVLVAVSGGLDSMNLFHLLYECKQVLGIELGIAHINHGQRE
ESVIEEKYLRQLAEESNVPFYLSYFEGVFSEEAARKWRYGFFATIMEKEGYTALVTAHHA
DDQAETVFMRLIRGGRLRHLSAIQPTQPFATGELIRPLLSFKKADFEKLFHFEDCSNADF
KYFRNRVRNDYLPKLKQENPKIELTLNNLAVDTNNLFQALRDLTQDLSVTDVMSFQQQTP
AVQSYLLEEYLEKFPDLQLSRPQFNEVLHILRSKANYYHLLKNDYMLEKDYHRFQIYKIG
PETDSQPEKIMIESEGIFSYGSYIFSLNHPLEEADSILYFPTENPIVVRRRQAGDTILIN
GVNKKLRRWFIDNKISQKVRQNALIIEQNGEIYGITNLVSSDLSKSVKNDIIKATLYIKM
KE
Download sequence
Identical sequences A0A0H3MSQ7 A0A123VWB6 A4VS98 D5AF63
gi|253752835|ref|YP_003025975.1| gi|403060716|ref|YP_006648932.1| gi|146317675|ref|YP_001197387.1| gi|386577015|ref|YP_006073420.1| WP_011921636.1.10007 WP_011921636.1.100280 WP_011921636.1.100404 WP_011921636.1.100490 WP_011921636.1.100701 WP_011921636.1.100908 WP_011921636.1.101179 WP_011921636.1.101295 WP_011921636.1.101621 WP_011921636.1.101658 WP_011921636.1.101706 WP_011921636.1.102038 WP_011921636.1.10265 WP_011921636.1.1035 WP_011921636.1.10700 WP_011921636.1.10896 WP_011921636.1.11017 WP_011921636.1.11548 WP_011921636.1.11662 WP_011921636.1.11869 WP_011921636.1.1200 WP_011921636.1.12022 WP_011921636.1.12228 WP_011921636.1.12288 WP_011921636.1.1244 WP_011921636.1.12606 WP_011921636.1.12803 WP_011921636.1.13095 WP_011921636.1.13380 WP_011921636.1.13633 WP_011921636.1.13861 WP_011921636.1.1405 WP_011921636.1.14202 WP_011921636.1.14210 WP_011921636.1.1424 WP_011921636.1.1434 WP_011921636.1.14359 WP_011921636.1.1495 WP_011921636.1.15112 WP_011921636.1.1537 WP_011921636.1.15393 WP_011921636.1.15545 WP_011921636.1.15756 WP_011921636.1.15813 WP_011921636.1.16193 WP_011921636.1.1629 WP_011921636.1.16498 WP_011921636.1.16643 WP_011921636.1.16683 WP_011921636.1.16773 WP_011921636.1.16829 WP_011921636.1.16881 WP_011921636.1.17264 WP_011921636.1.17670 WP_011921636.1.17749 WP_011921636.1.17814 WP_011921636.1.17958 WP_011921636.1.17989 WP_011921636.1.18271 WP_011921636.1.18341 WP_011921636.1.18403 WP_011921636.1.18563 WP_011921636.1.18711 WP_011921636.1.18850 WP_011921636.1.19352 WP_011921636.1.19378 WP_011921636.1.1953 WP_011921636.1.19865 WP_011921636.1.19898 WP_011921636.1.20400 WP_011921636.1.20518 WP_011921636.1.20584 WP_011921636.1.20756 WP_011921636.1.20944 WP_011921636.1.21072 WP_011921636.1.21347 WP_011921636.1.21457 WP_011921636.1.21903 WP_011921636.1.22785 WP_011921636.1.22882 WP_011921636.1.23089 WP_011921636.1.23273 WP_011921636.1.23317 WP_011921636.1.23358 WP_011921636.1.23682 WP_011921636.1.23965 WP_011921636.1.24078 WP_011921636.1.24150 WP_011921636.1.24175 WP_011921636.1.24187 WP_011921636.1.24431 WP_011921636.1.24858 WP_011921636.1.24883 WP_011921636.1.25245 WP_011921636.1.25280 WP_011921636.1.25381 WP_011921636.1.25396 WP_011921636.1.25617 WP_011921636.1.25711 WP_011921636.1.25798 WP_011921636.1.25824 WP_011921636.1.25950 WP_011921636.1.26009 WP_011921636.1.26302 WP_011921636.1.26368 WP_011921636.1.26620 WP_011921636.1.27108 WP_011921636.1.27225 WP_011921636.1.27227 WP_011921636.1.27381 WP_011921636.1.27476 WP_011921636.1.27695 WP_011921636.1.27754 WP_011921636.1.27760 WP_011921636.1.27767 WP_011921636.1.28000 WP_011921636.1.28033 WP_011921636.1.28244 WP_011921636.1.28467 WP_011921636.1.28645 WP_011921636.1.28796 WP_011921636.1.28805 WP_011921636.1.29141 WP_011921636.1.29610 WP_011921636.1.29635 WP_011921636.1.30079 WP_011921636.1.30241 WP_011921636.1.30344 WP_011921636.1.30414 WP_011921636.1.30562 WP_011921636.1.30785 WP_011921636.1.31597 WP_011921636.1.31707 WP_011921636.1.31730 WP_011921636.1.31763 WP_011921636.1.32048 WP_011921636.1.32259 WP_011921636.1.32332 WP_011921636.1.32466 WP_011921636.1.32630 WP_011921636.1.32947 WP_011921636.1.33330 WP_011921636.1.34321 WP_011921636.1.34425 WP_011921636.1.34527 WP_011921636.1.34652 WP_011921636.1.34738 WP_011921636.1.35430 WP_011921636.1.35551 WP_011921636.1.35675 WP_011921636.1.35725 WP_011921636.1.36136 WP_011921636.1.36251 WP_011921636.1.36341 WP_011921636.1.36611 WP_011921636.1.36766 WP_011921636.1.36945 WP_011921636.1.37126 WP_011921636.1.37237 WP_011921636.1.376 WP_011921636.1.37653 WP_011921636.1.37688 WP_011921636.1.37816 WP_011921636.1.37841 WP_011921636.1.37915 WP_011921636.1.38409 WP_011921636.1.38470 WP_011921636.1.39011 WP_011921636.1.39023 WP_011921636.1.39247 WP_011921636.1.39280 WP_011921636.1.39714 WP_011921636.1.3989 WP_011921636.1.40062 WP_011921636.1.40141 WP_011921636.1.40228 WP_011921636.1.40384 WP_011921636.1.40507 WP_011921636.1.40669 WP_011921636.1.4074 WP_011921636.1.40802 WP_011921636.1.41046 WP_011921636.1.41112 WP_011921636.1.41280 WP_011921636.1.41340 WP_011921636.1.41854 WP_011921636.1.42323 WP_011921636.1.42552 WP_011921636.1.42596 WP_011921636.1.42732 WP_011921636.1.4278 WP_011921636.1.42784 WP_011921636.1.42827 WP_011921636.1.42840 WP_011921636.1.4291 WP_011921636.1.43264 WP_011921636.1.43288 WP_011921636.1.43482 WP_011921636.1.43813 WP_011921636.1.43922 WP_011921636.1.43963 WP_011921636.1.43977 WP_011921636.1.44047 WP_011921636.1.44128 WP_011921636.1.44592 WP_011921636.1.44676 WP_011921636.1.44778 WP_011921636.1.45088 WP_011921636.1.45216 WP_011921636.1.45219 WP_011921636.1.45278 WP_011921636.1.45345 WP_011921636.1.45864 WP_011921636.1.45936 WP_011921636.1.467 WP_011921636.1.46880 WP_011921636.1.47315 WP_011921636.1.47375 WP_011921636.1.47434 WP_011921636.1.4748 WP_011921636.1.4757 WP_011921636.1.47643 WP_011921636.1.47745 WP_011921636.1.47894 WP_011921636.1.47900 WP_011921636.1.48167 WP_011921636.1.48217 WP_011921636.1.48397 WP_011921636.1.48603 WP_011921636.1.49093 WP_011921636.1.49099 WP_011921636.1.49206 WP_011921636.1.49255 WP_011921636.1.49368 WP_011921636.1.49413 WP_011921636.1.49509 WP_011921636.1.49782 WP_011921636.1.49968 WP_011921636.1.50047 WP_011921636.1.5021 WP_011921636.1.50437 WP_011921636.1.50538 WP_011921636.1.50551 WP_011921636.1.50675 WP_011921636.1.50751 WP_011921636.1.5079 WP_011921636.1.50798 WP_011921636.1.51263 WP_011921636.1.51386 WP_011921636.1.51551 WP_011921636.1.52159 WP_011921636.1.52175 WP_011921636.1.52599 WP_011921636.1.52628 WP_011921636.1.52798 WP_011921636.1.53174 WP_011921636.1.53290 WP_011921636.1.53309 WP_011921636.1.534 WP_011921636.1.53448 WP_011921636.1.53487 WP_011921636.1.53749 WP_011921636.1.53805 WP_011921636.1.53918 WP_011921636.1.54000 WP_011921636.1.5404 WP_011921636.1.54184 WP_011921636.1.54384 WP_011921636.1.54488 WP_011921636.1.54535 WP_011921636.1.54683 WP_011921636.1.54800 WP_011921636.1.54828 WP_011921636.1.55064 WP_011921636.1.55137 WP_011921636.1.55158 WP_011921636.1.55649 WP_011921636.1.55687 WP_011921636.1.5579 WP_011921636.1.55815 WP_011921636.1.55833 WP_011921636.1.55834 WP_011921636.1.56140 WP_011921636.1.56215 WP_011921636.1.56434 WP_011921636.1.56463 WP_011921636.1.57067 WP_011921636.1.5714 WP_011921636.1.57164 WP_011921636.1.57189 WP_011921636.1.5754 WP_011921636.1.57640 WP_011921636.1.57674 WP_011921636.1.57810 WP_011921636.1.58229 WP_011921636.1.58517 WP_011921636.1.58566 WP_011921636.1.58585 WP_011921636.1.58746 WP_011921636.1.58793 WP_011921636.1.58815 WP_011921636.1.58903 WP_011921636.1.59071 WP_011921636.1.59138 WP_011921636.1.59144 WP_011921636.1.59283 WP_011921636.1.59349 WP_011921636.1.5936 WP_011921636.1.59524 WP_011921636.1.59647 WP_011921636.1.5974 WP_011921636.1.60237 WP_011921636.1.60293 WP_011921636.1.60377 WP_011921636.1.60445 WP_011921636.1.60658 WP_011921636.1.60659 WP_011921636.1.60853 WP_011921636.1.609 WP_011921636.1.61370 WP_011921636.1.61533 WP_011921636.1.61540 WP_011921636.1.6156 WP_011921636.1.6165 WP_011921636.1.61782 WP_011921636.1.6223 WP_011921636.1.62268 WP_011921636.1.62485 WP_011921636.1.6278 WP_011921636.1.62805 WP_011921636.1.63318 WP_011921636.1.63653 WP_011921636.1.63685 WP_011921636.1.63959 WP_011921636.1.64128 WP_011921636.1.64273 WP_011921636.1.64281 WP_011921636.1.64384 WP_011921636.1.64641 WP_011921636.1.64797 WP_011921636.1.64952 WP_011921636.1.65024 WP_011921636.1.65047 WP_011921636.1.65174 WP_011921636.1.65314 WP_011921636.1.65422 WP_011921636.1.65458 WP_011921636.1.65905 WP_011921636.1.65911 WP_011921636.1.65917 WP_011921636.1.6596 WP_011921636.1.66185 WP_011921636.1.66472 WP_011921636.1.66590 WP_011921636.1.66609 WP_011921636.1.66707 WP_011921636.1.6686 WP_011921636.1.66954 WP_011921636.1.67058 WP_011921636.1.67109 WP_011921636.1.6711 WP_011921636.1.67256 WP_011921636.1.67338 WP_011921636.1.67488 WP_011921636.1.677 WP_011921636.1.67883 WP_011921636.1.67897 WP_011921636.1.67958 WP_011921636.1.67962 WP_011921636.1.68010 WP_011921636.1.68303 WP_011921636.1.68602 WP_011921636.1.68666 WP_011921636.1.68739 WP_011921636.1.68791 WP_011921636.1.68941 WP_011921636.1.69115 WP_011921636.1.69161 WP_011921636.1.69413 WP_011921636.1.69454 WP_011921636.1.69698 WP_011921636.1.69706 WP_011921636.1.69922 WP_011921636.1.70033 WP_011921636.1.70387 WP_011921636.1.70403 WP_011921636.1.70817 WP_011921636.1.70997 WP_011921636.1.71125 WP_011921636.1.71140 WP_011921636.1.71425 WP_011921636.1.71498 WP_011921636.1.71727 WP_011921636.1.72174 WP_011921636.1.72247 WP_011921636.1.72296 WP_011921636.1.72413 WP_011921636.1.7257 WP_011921636.1.73011 WP_011921636.1.73262 WP_011921636.1.73280 WP_011921636.1.73299 WP_011921636.1.73679 WP_011921636.1.73721 WP_011921636.1.73905 WP_011921636.1.74567 WP_011921636.1.74800 WP_011921636.1.74843 WP_011921636.1.74865 WP_011921636.1.75022 WP_011921636.1.75028 WP_011921636.1.75605 WP_011921636.1.75930 WP_011921636.1.75965 WP_011921636.1.75985 WP_011921636.1.76083 WP_011921636.1.76175 WP_011921636.1.76400 WP_011921636.1.76735 WP_011921636.1.76907 WP_011921636.1.77616 WP_011921636.1.77624 WP_011921636.1.7763 WP_011921636.1.77781 WP_011921636.1.77795 WP_011921636.1.77958 WP_011921636.1.78326 WP_011921636.1.78456 WP_011921636.1.7873 WP_011921636.1.78744 WP_011921636.1.78792 WP_011921636.1.7889 WP_011921636.1.78945 WP_011921636.1.79054 WP_011921636.1.79154 WP_011921636.1.79162 WP_011921636.1.79499 WP_011921636.1.79610 WP_011921636.1.79644 WP_011921636.1.79679 WP_011921636.1.80097 WP_011921636.1.80131 WP_011921636.1.80153 WP_011921636.1.80169 WP_011921636.1.80216 WP_011921636.1.80235 WP_011921636.1.80418 WP_011921636.1.8061 WP_011921636.1.80716 WP_011921636.1.80742 WP_011921636.1.81103 WP_011921636.1.81513 WP_011921636.1.81584 WP_011921636.1.81705 WP_011921636.1.82122 WP_011921636.1.82418 WP_011921636.1.8251 WP_011921636.1.82830 WP_011921636.1.82870 WP_011921636.1.82977 WP_011921636.1.83818 WP_011921636.1.83915 WP_011921636.1.84389 WP_011921636.1.84489 WP_011921636.1.8451 WP_011921636.1.84535 WP_011921636.1.85051 WP_011921636.1.85075 WP_011921636.1.85327 WP_011921636.1.85437 WP_011921636.1.85450 WP_011921636.1.85908 WP_011921636.1.86151 WP_011921636.1.86177 WP_011921636.1.86817 WP_011921636.1.86836 WP_011921636.1.86842 WP_011921636.1.87321 WP_011921636.1.87344 WP_011921636.1.87438 WP_011921636.1.87450 WP_011921636.1.87819 WP_011921636.1.87874 WP_011921636.1.87885 WP_011921636.1.8790 WP_011921636.1.88543 WP_011921636.1.88575 WP_011921636.1.88653 WP_011921636.1.88779 WP_011921636.1.89037 WP_011921636.1.89128 WP_011921636.1.89156 WP_011921636.1.89279 WP_011921636.1.89358 WP_011921636.1.89388 WP_011921636.1.89800 WP_011921636.1.8993 WP_011921636.1.89989 WP_011921636.1.90172 WP_011921636.1.90419 WP_011921636.1.90742 WP_011921636.1.90961 WP_011921636.1.91238 WP_011921636.1.91636 WP_011921636.1.91865 WP_011921636.1.91912 WP_011921636.1.91973 WP_011921636.1.91983 WP_011921636.1.92134 WP_011921636.1.92263 WP_011921636.1.92441 WP_011921636.1.92554 WP_011921636.1.92692 WP_011921636.1.92722 WP_011921636.1.928 WP_011921636.1.92964 WP_011921636.1.93190 WP_011921636.1.93456 WP_011921636.1.93519 WP_011921636.1.9361 WP_011921636.1.93627 WP_011921636.1.93646 WP_011921636.1.9376 WP_011921636.1.93771 WP_011921636.1.94338 WP_011921636.1.94418 WP_011921636.1.94419 WP_011921636.1.94449 WP_011921636.1.9454 WP_011921636.1.94639 WP_011921636.1.94786 WP_011921636.1.94945 WP_011921636.1.95180 WP_011921636.1.95213 WP_011921636.1.95214 WP_011921636.1.95262 WP_011921636.1.95288 WP_011921636.1.95542 WP_011921636.1.95798 WP_011921636.1.96164 WP_011921636.1.96282 WP_011921636.1.96451 WP_011921636.1.9652 WP_011921636.1.96524 WP_011921636.1.96574 WP_011921636.1.96700 WP_011921636.1.96973 WP_011921636.1.97052 WP_011921636.1.97453 WP_011921636.1.97493 WP_011921636.1.97504 WP_011921636.1.97515 WP_011921636.1.97554 WP_011921636.1.97857 WP_011921636.1.9809 WP_011921636.1.9815 WP_011921636.1.98253 WP_011921636.1.98271 WP_011921636.1.98326 WP_011921636.1.98343 WP_011921636.1.98416 WP_011921636.1.98860 WP_011921636.1.98864 WP_011921636.1.98921 WP_011921636.1.99127 WP_011921636.1.9922 WP_011921636.1.99252 WP_011921636.1.99324 WP_011921636.1.99696 WP_011921636.1.99988 YP_003027800.1.79686 gi|386587294|ref|YP_006083695.1| gi|253754660|ref|YP_003027800.1| gi|386581060|ref|YP_006077464.1| 218494.SSU0013 391295.SSU05_0013 391296.SSU98_0016 568813.SSUSC84_0013 568814.SSUBM407_0013 gi|253750936|ref|YP_003024077.1| gi|146319865|ref|YP_001199576.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]