SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|253753716|ref|YP_003026857.1| from Streptococcus suis P1/7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|253753716|ref|YP_003026857.1|
Domain Number 1 Region: 215-401
Classification Level Classification E-value
Superfamily PheT/TilS domain 6.8e-66
Family B3/B4 domain of PheRS, PheT 0.0000117
Further Details:      
 
Domain Number 2 Region: 471-693
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.39e-47
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00028
Further Details:      
 
Domain Number 3 Region: 37-194
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 5.43e-42
Family Myf domain 0.0018
Further Details:      
 
Domain Number 4 Region: 703-799
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 4.45e-29
Family Anticodon-binding domain of PheRS 0.00074
Further Details:      
 
Domain Number 5 Region: 409-479
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 3.94e-20
Family Domains B1 and B5 of PheRS-beta, PheT 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|253753716|ref|YP_003026857.1|
Sequence length 799
Comment phenylalanyl-tRNA synthetase subunit beta [Streptococcus suis P1/7]
Sequence
MLVSYKWLKELVDFDATSHDLSEKMSTTGIEVEGVEQKSAGLSKLVVGQVVSAEPIPDTH
LNICQVNVGEAITQIVCGAPNVKPGIKVIVALPGARIAGNYKIKKGKIRGVESLGMLCSL
SEIGVSDSVVPKVYADGIYHLPEDAVVGEPVFSYLDLDDEIIELSITPNRADALSMRGVA
HEVAAIYDSKVNFKPVVLEESDKKASDVIEVAIESDKVTAYTARVIENVTIAPSPQWLQN
LLMNAGIRPLNNVVDITNYILLYFGQPMHAFDFDKFEGKKIVARQAKEGENLVTLDGEER
DLIADDIVISVADKAVALGGVMGGASTEIDNSSKTVVLEAALFDGKSIRKTSGRLNLRSE
SSSRFEKGINVATLTEAMDTAAAMIAELAGGQVLSGIVSAGSVDTSDVPVTATIDYVNRS
LGTNLDYAQIADIFRRLGMETTGDASQFTVAVPRRRWDIRIPADLVEEIARIYGYNNLPT
TLPKEDGTAGELTLTQNIRRQVRSLAEGAGLTEIISYALTTPDKAVEFVARPTTVTELMW
PMTVDRSALRQNMVSGMLDTVAYNVARKNKNLALYEIGKIFEQSGNPKEDLPQEINKFAL
VLTGLVAEKDFQTPAVPVDFFHAKGILEAIFDHYKLAVDFVATSEIAALHPGRTAEIHLN
GAVIGFVGQVHPQTAKDYGIPETYVAEINLDAIEEALQPAQPFTDISKFPAVSRDIALLL
NSDVKHQDVLDAIAGAGVKRLTKVTLFDVYAGSNIEVGKKSMAYNLTFQNPEDSLTDEEV
AKYMEKISKSLETLGAEIR
Download sequence
Identical sequences A0A2I8YA35 A4VVH7 D5AI04
gi|253751893|ref|YP_003025034.1| 218494.SSU0995 391295.SSU05_1150 391296.SSU98_1166 568813.SSUSC84_1033 gi|386582087|ref|YP_006078491.1| gi|253753716|ref|YP_003026857.1| WP_012027118.1.10007 WP_012027118.1.100404 WP_012027118.1.100701 WP_012027118.1.100908 WP_012027118.1.101097 WP_012027118.1.101179 WP_012027118.1.101295 WP_012027118.1.101658 WP_012027118.1.101706 WP_012027118.1.102038 WP_012027118.1.10265 WP_012027118.1.1035 WP_012027118.1.10896 WP_012027118.1.11330 WP_012027118.1.11548 WP_012027118.1.11662 WP_012027118.1.11869 WP_012027118.1.11874 WP_012027118.1.1200 WP_012027118.1.12022 WP_012027118.1.12228 WP_012027118.1.12606 WP_012027118.1.12803 WP_012027118.1.1324 WP_012027118.1.13380 WP_012027118.1.13633 WP_012027118.1.13861 WP_012027118.1.1405 WP_012027118.1.14202 WP_012027118.1.14210 WP_012027118.1.1424 WP_012027118.1.1434 WP_012027118.1.14359 WP_012027118.1.1495 WP_012027118.1.15112 WP_012027118.1.1537 WP_012027118.1.15393 WP_012027118.1.15545 WP_012027118.1.15813 WP_012027118.1.16193 WP_012027118.1.1629 WP_012027118.1.16643 WP_012027118.1.16773 WP_012027118.1.17264 WP_012027118.1.17749 WP_012027118.1.17958 WP_012027118.1.17989 WP_012027118.1.18271 WP_012027118.1.18341 WP_012027118.1.18563 WP_012027118.1.18711 WP_012027118.1.18850 WP_012027118.1.19352 WP_012027118.1.19378 WP_012027118.1.1953 WP_012027118.1.19865 WP_012027118.1.20400 WP_012027118.1.20518 WP_012027118.1.20584 WP_012027118.1.20756 WP_012027118.1.20944 WP_012027118.1.21347 WP_012027118.1.21457 WP_012027118.1.22785 WP_012027118.1.23089 WP_012027118.1.23273 WP_012027118.1.23317 WP_012027118.1.23358 WP_012027118.1.24078 WP_012027118.1.24150 WP_012027118.1.24175 WP_012027118.1.24187 WP_012027118.1.24858 WP_012027118.1.24883 WP_012027118.1.25280 WP_012027118.1.25381 WP_012027118.1.25396 WP_012027118.1.25824 WP_012027118.1.25950 WP_012027118.1.26009 WP_012027118.1.26302 WP_012027118.1.26368 WP_012027118.1.27108 WP_012027118.1.27225 WP_012027118.1.27381 WP_012027118.1.27476 WP_012027118.1.27754 WP_012027118.1.27760 WP_012027118.1.27767 WP_012027118.1.28000 WP_012027118.1.28033 WP_012027118.1.28244 WP_012027118.1.28467 WP_012027118.1.28796 WP_012027118.1.28805 WP_012027118.1.29141 WP_012027118.1.29610 WP_012027118.1.30241 WP_012027118.1.30414 WP_012027118.1.30785 WP_012027118.1.31597 WP_012027118.1.31730 WP_012027118.1.32259 WP_012027118.1.32466 WP_012027118.1.32630 WP_012027118.1.32947 WP_012027118.1.33330 WP_012027118.1.34321 WP_012027118.1.34425 WP_012027118.1.34527 WP_012027118.1.34738 WP_012027118.1.35430 WP_012027118.1.35551 WP_012027118.1.35675 WP_012027118.1.36136 WP_012027118.1.36341 WP_012027118.1.36611 WP_012027118.1.36766 WP_012027118.1.36945 WP_012027118.1.37126 WP_012027118.1.37237 WP_012027118.1.376 WP_012027118.1.37653 WP_012027118.1.37841 WP_012027118.1.38409 WP_012027118.1.38470 WP_012027118.1.39011 WP_012027118.1.39023 WP_012027118.1.39247 WP_012027118.1.39280 WP_012027118.1.39714 WP_012027118.1.3989 WP_012027118.1.40062 WP_012027118.1.40141 WP_012027118.1.40228 WP_012027118.1.40384 WP_012027118.1.40507 WP_012027118.1.40669 WP_012027118.1.4074 WP_012027118.1.40802 WP_012027118.1.41046 WP_012027118.1.41112 WP_012027118.1.41280 WP_012027118.1.41340 WP_012027118.1.42323 WP_012027118.1.42552 WP_012027118.1.42596 WP_012027118.1.42732 WP_012027118.1.4278 WP_012027118.1.42784 WP_012027118.1.42840 WP_012027118.1.4291 WP_012027118.1.43264 WP_012027118.1.43288 WP_012027118.1.43482 WP_012027118.1.43813 WP_012027118.1.43922 WP_012027118.1.43963 WP_012027118.1.43977 WP_012027118.1.44047 WP_012027118.1.44128 WP_012027118.1.44676 WP_012027118.1.44778 WP_012027118.1.45088 WP_012027118.1.45216 WP_012027118.1.45219 WP_012027118.1.45345 WP_012027118.1.45864 WP_012027118.1.45936 WP_012027118.1.467 WP_012027118.1.46880 WP_012027118.1.47315 WP_012027118.1.47434 WP_012027118.1.4748 WP_012027118.1.4757 WP_012027118.1.47894 WP_012027118.1.47900 WP_012027118.1.48167 WP_012027118.1.48217 WP_012027118.1.48397 WP_012027118.1.48603 WP_012027118.1.49093 WP_012027118.1.49206 WP_012027118.1.49255 WP_012027118.1.49368 WP_012027118.1.49413 WP_012027118.1.49509 WP_012027118.1.49782 WP_012027118.1.49968 WP_012027118.1.50047 WP_012027118.1.50437 WP_012027118.1.50538 WP_012027118.1.50551 WP_012027118.1.50675 WP_012027118.1.50751 WP_012027118.1.5079 WP_012027118.1.50798 WP_012027118.1.51386 WP_012027118.1.51551 WP_012027118.1.52159 WP_012027118.1.52175 WP_012027118.1.52599 WP_012027118.1.52628 WP_012027118.1.52798 WP_012027118.1.53174 WP_012027118.1.53290 WP_012027118.1.53309 WP_012027118.1.534 WP_012027118.1.53487 WP_012027118.1.53805 WP_012027118.1.54000 WP_012027118.1.5404 WP_012027118.1.54184 WP_012027118.1.54384 WP_012027118.1.54488 WP_012027118.1.54535 WP_012027118.1.54828 WP_012027118.1.55158 WP_012027118.1.55649 WP_012027118.1.55687 WP_012027118.1.5579 WP_012027118.1.55833 WP_012027118.1.55834 WP_012027118.1.56463 WP_012027118.1.57067 WP_012027118.1.5714 WP_012027118.1.5754 WP_012027118.1.57640 WP_012027118.1.57674 WP_012027118.1.57810 WP_012027118.1.58229 WP_012027118.1.58517 WP_012027118.1.58566 WP_012027118.1.58706 WP_012027118.1.58746 WP_012027118.1.58793 WP_012027118.1.58903 WP_012027118.1.59071 WP_012027118.1.59144 WP_012027118.1.59283 WP_012027118.1.59349 WP_012027118.1.5936 WP_012027118.1.59524 WP_012027118.1.5974 WP_012027118.1.60237 WP_012027118.1.60445 WP_012027118.1.60853 WP_012027118.1.609 WP_012027118.1.61533 WP_012027118.1.61540 WP_012027118.1.6156 WP_012027118.1.6165 WP_012027118.1.61782 WP_012027118.1.6223 WP_012027118.1.62485 WP_012027118.1.6278 WP_012027118.1.62805 WP_012027118.1.63318 WP_012027118.1.63685 WP_012027118.1.63959 WP_012027118.1.64128 WP_012027118.1.64273 WP_012027118.1.64281 WP_012027118.1.64384 WP_012027118.1.64641 WP_012027118.1.64797 WP_012027118.1.64952 WP_012027118.1.65024 WP_012027118.1.65047 WP_012027118.1.65422 WP_012027118.1.65458 WP_012027118.1.65905 WP_012027118.1.65911 WP_012027118.1.65917 WP_012027118.1.6596 WP_012027118.1.66185 WP_012027118.1.66472 WP_012027118.1.66590 WP_012027118.1.66707 WP_012027118.1.6686 WP_012027118.1.67058 WP_012027118.1.67109 WP_012027118.1.6711 WP_012027118.1.677 WP_012027118.1.67962 WP_012027118.1.68010 WP_012027118.1.68303 WP_012027118.1.68602 WP_012027118.1.68666 WP_012027118.1.68791 WP_012027118.1.69115 WP_012027118.1.69413 WP_012027118.1.69454 WP_012027118.1.69706 WP_012027118.1.69922 WP_012027118.1.70033 WP_012027118.1.70387 WP_012027118.1.70997 WP_012027118.1.71125 WP_012027118.1.71140 WP_012027118.1.71425 WP_012027118.1.71727 WP_012027118.1.72247 WP_012027118.1.72296 WP_012027118.1.72413 WP_012027118.1.7257 WP_012027118.1.73011 WP_012027118.1.73262 WP_012027118.1.73280 WP_012027118.1.73299 WP_012027118.1.73679 WP_012027118.1.73721 WP_012027118.1.73905 WP_012027118.1.74567 WP_012027118.1.74843 WP_012027118.1.74865 WP_012027118.1.75028 WP_012027118.1.75605 WP_012027118.1.75930 WP_012027118.1.75985 WP_012027118.1.76083 WP_012027118.1.76175 WP_012027118.1.76400 WP_012027118.1.76735 WP_012027118.1.76907 WP_012027118.1.77616 WP_012027118.1.77624 WP_012027118.1.77781 WP_012027118.1.77795 WP_012027118.1.77958 WP_012027118.1.78326 WP_012027118.1.7873 WP_012027118.1.78945 WP_012027118.1.79054 WP_012027118.1.79162 WP_012027118.1.79499 WP_012027118.1.80097 WP_012027118.1.80131 WP_012027118.1.80153 WP_012027118.1.80216 WP_012027118.1.80418 WP_012027118.1.8061 WP_012027118.1.80716 WP_012027118.1.80742 WP_012027118.1.81103 WP_012027118.1.81370 WP_012027118.1.81513 WP_012027118.1.81584 WP_012027118.1.81705 WP_012027118.1.8251 WP_012027118.1.82870 WP_012027118.1.82977 WP_012027118.1.83818 WP_012027118.1.83915 WP_012027118.1.84389 WP_012027118.1.8451 WP_012027118.1.85051 WP_012027118.1.85075 WP_012027118.1.85437 WP_012027118.1.85908 WP_012027118.1.86151 WP_012027118.1.86177 WP_012027118.1.86817 WP_012027118.1.87044 WP_012027118.1.87321 WP_012027118.1.87819 WP_012027118.1.87885 WP_012027118.1.8790 WP_012027118.1.88543 WP_012027118.1.88575 WP_012027118.1.88653 WP_012027118.1.88779 WP_012027118.1.89037 WP_012027118.1.89038 WP_012027118.1.89056 WP_012027118.1.89279 WP_012027118.1.89358 WP_012027118.1.89388 WP_012027118.1.89800 WP_012027118.1.8993 WP_012027118.1.89989 WP_012027118.1.90172 WP_012027118.1.90742 WP_012027118.1.90961 WP_012027118.1.91238 WP_012027118.1.91865 WP_012027118.1.91912 WP_012027118.1.91973 WP_012027118.1.91983 WP_012027118.1.92134 WP_012027118.1.92263 WP_012027118.1.92441 WP_012027118.1.92554 WP_012027118.1.92692 WP_012027118.1.92722 WP_012027118.1.93190 WP_012027118.1.93519 WP_012027118.1.9361 WP_012027118.1.93627 WP_012027118.1.93646 WP_012027118.1.9376 WP_012027118.1.94332 WP_012027118.1.94338 WP_012027118.1.94449 WP_012027118.1.9454 WP_012027118.1.94639 WP_012027118.1.94786 WP_012027118.1.95180 WP_012027118.1.95213 WP_012027118.1.95214 WP_012027118.1.95262 WP_012027118.1.95288 WP_012027118.1.95542 WP_012027118.1.95798 WP_012027118.1.96164 WP_012027118.1.96282 WP_012027118.1.9652 WP_012027118.1.96524 WP_012027118.1.96574 WP_012027118.1.96700 WP_012027118.1.97052 WP_012027118.1.97453 WP_012027118.1.97493 WP_012027118.1.97554 WP_012027118.1.97857 WP_012027118.1.9809 WP_012027118.1.9815 WP_012027118.1.98253 WP_012027118.1.98271 WP_012027118.1.98343 WP_012027118.1.98416 WP_012027118.1.98860 WP_012027118.1.98864 WP_012027118.1.99127 WP_012027118.1.9922 WP_012027118.1.99252 WP_012027118.1.99324 WP_012027118.1.99988 gi|146321013|ref|YP_001200724.1| gi|476420023|ref|YP_007571019.1| gi|146318804|ref|YP_001198516.1| gi|386578005|ref|YP_006074411.1| gi|386580062|ref|YP_006076467.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]