SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|253754270|ref|YP_003027411.1| from Streptococcus suis P1/7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|253754270|ref|YP_003027411.1|
Domain Number 1 Region: 50-227
Classification Level Classification E-value
Superfamily PheT/TilS domain 2.09e-30
Family B3/B4 domain of PheRS, PheT 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|253754270|ref|YP_003027411.1|
Sequence length 234
Comment hypothetical protein SSU1573 [Streptococcus suis P1/7]
Sequence
MSQFVVDSSFWSLFPDAKIGVLLLKDYKTPAQSPDELVKLLEESNGIAQKFLTEDTFSEN
EVIRTYRQAYQKFKTKKGARSSIEALLKRSTSDRPVTTISPLVDIYNAASLRFGLPCGAE
DLDTFVGNLQLTVTEGGDEFYLIGDETNNPTLPGEVCYKDDKGAVCRCFNWRDGERTMIT
DETKNAFLVMELVNSDRVEDLENALDFISQHAEKFLGVVPEKYLLDCDRPAIAL
Download sequence
Identical sequences A0A0H3MWV7 A0A0Z9P8Z4 A4VX94 D5AJN5 U5UGP4
gi|253752444|ref|YP_003025585.1| gi|146321625|ref|YP_001201336.1| gi|253754270|ref|YP_003027411.1| gi|386580656|ref|YP_006077061.1| gi|386578586|ref|YP_006074992.1| gi|146319421|ref|YP_001199133.1| gi|386582731|ref|YP_006079135.1| gi|253756204|ref|YP_003029344.1| gi|476420578|ref|YP_007571574.1| gi|403062201|ref|YP_006650417.1| gi|386588854|ref|YP_006085255.1| WP_012027675.1.10007 WP_012027675.1.100280 WP_012027675.1.100404 WP_012027675.1.100490 WP_012027675.1.100670 WP_012027675.1.100701 WP_012027675.1.100908 WP_012027675.1.101097 WP_012027675.1.101179 WP_012027675.1.101295 WP_012027675.1.101447 WP_012027675.1.101621 WP_012027675.1.101658 WP_012027675.1.101706 WP_012027675.1.101901 WP_012027675.1.102038 WP_012027675.1.10265 WP_012027675.1.1035 WP_012027675.1.10700 WP_012027675.1.10896 WP_012027675.1.11017 WP_012027675.1.11330 WP_012027675.1.11527 WP_012027675.1.11548 WP_012027675.1.11662 WP_012027675.1.11869 WP_012027675.1.11874 WP_012027675.1.11918 WP_012027675.1.1200 WP_012027675.1.12022 WP_012027675.1.12228 WP_012027675.1.12288 WP_012027675.1.1244 WP_012027675.1.12606 WP_012027675.1.12665 WP_012027675.1.12803 WP_012027675.1.13051 WP_012027675.1.13095 WP_012027675.1.1324 WP_012027675.1.13380 WP_012027675.1.13633 WP_012027675.1.13861 WP_012027675.1.1405 WP_012027675.1.14202 WP_012027675.1.1424 WP_012027675.1.1434 WP_012027675.1.14359 WP_012027675.1.1495 WP_012027675.1.15112 WP_012027675.1.1537 WP_012027675.1.15393 WP_012027675.1.15414 WP_012027675.1.15545 WP_012027675.1.15756 WP_012027675.1.15813 WP_012027675.1.1608 WP_012027675.1.1616 WP_012027675.1.16193 WP_012027675.1.1629 WP_012027675.1.16498 WP_012027675.1.16643 WP_012027675.1.16677 WP_012027675.1.16683 WP_012027675.1.16773 WP_012027675.1.16829 WP_012027675.1.16881 WP_012027675.1.17264 WP_012027675.1.17388 WP_012027675.1.17670 WP_012027675.1.17749 WP_012027675.1.17814 WP_012027675.1.17958 WP_012027675.1.17989 WP_012027675.1.18271 WP_012027675.1.18341 WP_012027675.1.18403 WP_012027675.1.18563 WP_012027675.1.18711 WP_012027675.1.18850 WP_012027675.1.19145 WP_012027675.1.19352 WP_012027675.1.19378 WP_012027675.1.19521 WP_012027675.1.1953 WP_012027675.1.19865 WP_012027675.1.19898 WP_012027675.1.20400 WP_012027675.1.20518 WP_012027675.1.20584 WP_012027675.1.20756 WP_012027675.1.20944 WP_012027675.1.21072 WP_012027675.1.21347 WP_012027675.1.21348 WP_012027675.1.21374 WP_012027675.1.21457 WP_012027675.1.21903 WP_012027675.1.21994 WP_012027675.1.22785 WP_012027675.1.22848 WP_012027675.1.22882 WP_012027675.1.23089 WP_012027675.1.23273 WP_012027675.1.23317 WP_012027675.1.23358 WP_012027675.1.23682 WP_012027675.1.23965 WP_012027675.1.24078 WP_012027675.1.24150 WP_012027675.1.24175 WP_012027675.1.24187 WP_012027675.1.24431 WP_012027675.1.24858 WP_012027675.1.24883 WP_012027675.1.25245 WP_012027675.1.25280 WP_012027675.1.25381 WP_012027675.1.25396 WP_012027675.1.25617 WP_012027675.1.25711 WP_012027675.1.25798 WP_012027675.1.25824 WP_012027675.1.25841 WP_012027675.1.25950 WP_012027675.1.26009 WP_012027675.1.26302 WP_012027675.1.26324 WP_012027675.1.26368 WP_012027675.1.26507 WP_012027675.1.26620 WP_012027675.1.27108 WP_012027675.1.27225 WP_012027675.1.27227 WP_012027675.1.27381 WP_012027675.1.27476 WP_012027675.1.27695 WP_012027675.1.27754 WP_012027675.1.27760 WP_012027675.1.27767 WP_012027675.1.28000 WP_012027675.1.28033 WP_012027675.1.28244 WP_012027675.1.28467 WP_012027675.1.28645 WP_012027675.1.28796 WP_012027675.1.28805 WP_012027675.1.29141 WP_012027675.1.29299 WP_012027675.1.29542 WP_012027675.1.29545 WP_012027675.1.29610 WP_012027675.1.29635 WP_012027675.1.29935 WP_012027675.1.30079 WP_012027675.1.30136 WP_012027675.1.30241 WP_012027675.1.30414 WP_012027675.1.30562 WP_012027675.1.30785 WP_012027675.1.31425 WP_012027675.1.31597 WP_012027675.1.31707 WP_012027675.1.31730 WP_012027675.1.31763 WP_012027675.1.32048 WP_012027675.1.32259 WP_012027675.1.32292 WP_012027675.1.32332 WP_012027675.1.32380 WP_012027675.1.32466 WP_012027675.1.32537 WP_012027675.1.32630 WP_012027675.1.32947 WP_012027675.1.33330 WP_012027675.1.33471 WP_012027675.1.34321 WP_012027675.1.34425 WP_012027675.1.34527 WP_012027675.1.34652 WP_012027675.1.34738 WP_012027675.1.35430 WP_012027675.1.35551 WP_012027675.1.35675 WP_012027675.1.36136 WP_012027675.1.36180 WP_012027675.1.36251 WP_012027675.1.36341 WP_012027675.1.36437 WP_012027675.1.36611 WP_012027675.1.36766 WP_012027675.1.36945 WP_012027675.1.37126 WP_012027675.1.37237 WP_012027675.1.376 WP_012027675.1.37653 WP_012027675.1.37688 WP_012027675.1.37816 WP_012027675.1.37841 WP_012027675.1.37914 WP_012027675.1.37915 WP_012027675.1.38409 WP_012027675.1.38470 WP_012027675.1.38936 WP_012027675.1.39011 WP_012027675.1.39023 WP_012027675.1.39247 WP_012027675.1.39280 WP_012027675.1.39714 WP_012027675.1.3989 WP_012027675.1.40062 WP_012027675.1.40141 WP_012027675.1.40228 WP_012027675.1.40265 WP_012027675.1.40384 WP_012027675.1.40507 WP_012027675.1.40669 WP_012027675.1.4074 WP_012027675.1.40802 WP_012027675.1.41046 WP_012027675.1.41052 WP_012027675.1.41112 WP_012027675.1.41280 WP_012027675.1.41340 WP_012027675.1.41854 WP_012027675.1.42249 WP_012027675.1.42323 WP_012027675.1.42552 WP_012027675.1.42596 WP_012027675.1.42732 WP_012027675.1.4278 WP_012027675.1.42784 WP_012027675.1.42827 WP_012027675.1.42840 WP_012027675.1.4291 WP_012027675.1.43264 WP_012027675.1.43288 WP_012027675.1.43482 WP_012027675.1.43813 WP_012027675.1.43922 WP_012027675.1.43963 WP_012027675.1.43977 WP_012027675.1.44047 WP_012027675.1.44128 WP_012027675.1.44134 WP_012027675.1.44592 WP_012027675.1.44676 WP_012027675.1.44778 WP_012027675.1.45088 WP_012027675.1.45216 WP_012027675.1.45219 WP_012027675.1.45278 WP_012027675.1.4529 WP_012027675.1.45345 WP_012027675.1.45864 WP_012027675.1.467 WP_012027675.1.46880 WP_012027675.1.47108 WP_012027675.1.47119 WP_012027675.1.47315 WP_012027675.1.47375 WP_012027675.1.47434 WP_012027675.1.4748 WP_012027675.1.4757 WP_012027675.1.47643 WP_012027675.1.47745 WP_012027675.1.47894 WP_012027675.1.47900 WP_012027675.1.48167 WP_012027675.1.48217 WP_012027675.1.48397 WP_012027675.1.48583 WP_012027675.1.48603 WP_012027675.1.49093 WP_012027675.1.49099 WP_012027675.1.49206 WP_012027675.1.49255 WP_012027675.1.49368 WP_012027675.1.49413 WP_012027675.1.49509 WP_012027675.1.49782 WP_012027675.1.49968 WP_012027675.1.50047 WP_012027675.1.5021 WP_012027675.1.50437 WP_012027675.1.50538 WP_012027675.1.50551 WP_012027675.1.50675 WP_012027675.1.50751 WP_012027675.1.5079 WP_012027675.1.50798 WP_012027675.1.51263 WP_012027675.1.51386 WP_012027675.1.51551 WP_012027675.1.52159 WP_012027675.1.52175 WP_012027675.1.52599 WP_012027675.1.52628 WP_012027675.1.52798 WP_012027675.1.53174 WP_012027675.1.53290 WP_012027675.1.53309 WP_012027675.1.534 WP_012027675.1.53448 WP_012027675.1.53749 WP_012027675.1.53805 WP_012027675.1.53918 WP_012027675.1.54000 WP_012027675.1.54184 WP_012027675.1.54384 WP_012027675.1.54488 WP_012027675.1.54535 WP_012027675.1.54683 WP_012027675.1.54800 WP_012027675.1.54828 WP_012027675.1.55064 WP_012027675.1.55137 WP_012027675.1.55158 WP_012027675.1.55649 WP_012027675.1.55687 WP_012027675.1.5579 WP_012027675.1.55815 WP_012027675.1.55833 WP_012027675.1.55834 WP_012027675.1.56140 WP_012027675.1.56150 WP_012027675.1.56215 WP_012027675.1.56434 WP_012027675.1.56463 WP_012027675.1.56762 WP_012027675.1.57067 WP_012027675.1.5714 WP_012027675.1.57164 WP_012027675.1.57189 WP_012027675.1.5754 WP_012027675.1.57640 WP_012027675.1.57674 WP_012027675.1.57810 WP_012027675.1.58229 WP_012027675.1.58517 WP_012027675.1.58566 WP_012027675.1.58585 WP_012027675.1.58706 WP_012027675.1.58725 WP_012027675.1.58746 WP_012027675.1.58793 WP_012027675.1.58815 WP_012027675.1.58903 WP_012027675.1.58933 WP_012027675.1.59071 WP_012027675.1.59138 WP_012027675.1.59283 WP_012027675.1.59349 WP_012027675.1.5936 WP_012027675.1.59524 WP_012027675.1.59647 WP_012027675.1.5974 WP_012027675.1.59929 WP_012027675.1.60237 WP_012027675.1.60293 WP_012027675.1.60377 WP_012027675.1.60445 WP_012027675.1.60658 WP_012027675.1.60659 WP_012027675.1.60853 WP_012027675.1.609 WP_012027675.1.61370 WP_012027675.1.61415 WP_012027675.1.61533 WP_012027675.1.61540 WP_012027675.1.6156 WP_012027675.1.6165 WP_012027675.1.61715 WP_012027675.1.61782 WP_012027675.1.61885 WP_012027675.1.6223 WP_012027675.1.62268 WP_012027675.1.62485 WP_012027675.1.62710 WP_012027675.1.6272 WP_012027675.1.6278 WP_012027675.1.62805 WP_012027675.1.63018 WP_012027675.1.63174 WP_012027675.1.63318 WP_012027675.1.63653 WP_012027675.1.63685 WP_012027675.1.63959 WP_012027675.1.64120 WP_012027675.1.64128 WP_012027675.1.64273 WP_012027675.1.64281 WP_012027675.1.64384 WP_012027675.1.64641 WP_012027675.1.64797 WP_012027675.1.64952 WP_012027675.1.65024 WP_012027675.1.65047 WP_012027675.1.65174 WP_012027675.1.65314 WP_012027675.1.65422 WP_012027675.1.65458 WP_012027675.1.65905 WP_012027675.1.65911 WP_012027675.1.65917 WP_012027675.1.6596 WP_012027675.1.66185 WP_012027675.1.66300 WP_012027675.1.66472 WP_012027675.1.66590 WP_012027675.1.66609 WP_012027675.1.6686 WP_012027675.1.66954 WP_012027675.1.67058 WP_012027675.1.67109 WP_012027675.1.6711 WP_012027675.1.67256 WP_012027675.1.67338 WP_012027675.1.67488 WP_012027675.1.677 WP_012027675.1.67883 WP_012027675.1.67897 WP_012027675.1.67958 WP_012027675.1.67962 WP_012027675.1.68010 WP_012027675.1.68303 WP_012027675.1.68602 WP_012027675.1.68666 WP_012027675.1.68739 WP_012027675.1.68791 WP_012027675.1.68941 WP_012027675.1.69056 WP_012027675.1.69115 WP_012027675.1.69161 WP_012027675.1.69167 WP_012027675.1.69413 WP_012027675.1.69454 WP_012027675.1.69698 WP_012027675.1.69706 WP_012027675.1.69922 WP_012027675.1.70033 WP_012027675.1.70387 WP_012027675.1.70403 WP_012027675.1.70484 WP_012027675.1.70817 WP_012027675.1.70832 WP_012027675.1.70997 WP_012027675.1.71125 WP_012027675.1.71140 WP_012027675.1.71425 WP_012027675.1.71432 WP_012027675.1.71498 WP_012027675.1.71727 WP_012027675.1.72174 WP_012027675.1.72247 WP_012027675.1.72296 WP_012027675.1.72413 WP_012027675.1.7257 WP_012027675.1.72611 WP_012027675.1.73011 WP_012027675.1.73165 WP_012027675.1.73262 WP_012027675.1.73280 WP_012027675.1.73299 WP_012027675.1.7342 WP_012027675.1.73679 WP_012027675.1.73721 WP_012027675.1.73905 WP_012027675.1.74090 WP_012027675.1.74567 WP_012027675.1.74800 WP_012027675.1.74843 WP_012027675.1.74865 WP_012027675.1.75022 WP_012027675.1.75028 WP_012027675.1.75605 WP_012027675.1.75930 WP_012027675.1.75965 WP_012027675.1.75985 WP_012027675.1.76083 WP_012027675.1.76175 WP_012027675.1.76400 WP_012027675.1.76666 WP_012027675.1.76735 WP_012027675.1.76907 WP_012027675.1.77006 WP_012027675.1.7754 WP_012027675.1.77616 WP_012027675.1.77624 WP_012027675.1.77781 WP_012027675.1.77795 WP_012027675.1.77958 WP_012027675.1.78138 WP_012027675.1.78326 WP_012027675.1.7873 WP_012027675.1.78744 WP_012027675.1.78792 WP_012027675.1.7889 WP_012027675.1.78945 WP_012027675.1.79054 WP_012027675.1.79154 WP_012027675.1.79162 WP_012027675.1.79499 WP_012027675.1.79644 WP_012027675.1.79679 WP_012027675.1.79807 WP_012027675.1.80097 WP_012027675.1.80131 WP_012027675.1.80153 WP_012027675.1.80169 WP_012027675.1.80216 WP_012027675.1.80235 WP_012027675.1.80418 WP_012027675.1.8061 WP_012027675.1.80716 WP_012027675.1.80742 WP_012027675.1.8083 WP_012027675.1.81103 WP_012027675.1.81370 WP_012027675.1.81513 WP_012027675.1.81584 WP_012027675.1.81705 WP_012027675.1.82122 WP_012027675.1.8251 WP_012027675.1.82830 WP_012027675.1.82870 WP_012027675.1.82977 WP_012027675.1.83818 WP_012027675.1.83915 WP_012027675.1.84389 WP_012027675.1.84412 WP_012027675.1.84489 WP_012027675.1.8451 WP_012027675.1.85075 WP_012027675.1.85327 WP_012027675.1.85333 WP_012027675.1.85437 WP_012027675.1.85908 WP_012027675.1.86151 WP_012027675.1.86177 WP_012027675.1.86817 WP_012027675.1.86836 WP_012027675.1.86842 WP_012027675.1.87044 WP_012027675.1.87321 WP_012027675.1.87344 WP_012027675.1.87438 WP_012027675.1.87450 WP_012027675.1.87819 WP_012027675.1.87874 WP_012027675.1.87885 WP_012027675.1.8790 WP_012027675.1.88201 WP_012027675.1.88543 WP_012027675.1.88575 WP_012027675.1.88635 WP_012027675.1.88653 WP_012027675.1.88746 WP_012027675.1.88779 WP_012027675.1.88882 WP_012027675.1.88972 WP_012027675.1.89037 WP_012027675.1.89038 WP_012027675.1.89056 WP_012027675.1.89128 WP_012027675.1.89156 WP_012027675.1.89279 WP_012027675.1.89358 WP_012027675.1.89388 WP_012027675.1.89800 WP_012027675.1.8993 WP_012027675.1.89989 WP_012027675.1.90172 WP_012027675.1.90419 WP_012027675.1.90742 WP_012027675.1.90961 WP_012027675.1.91238 WP_012027675.1.91387 WP_012027675.1.91636 WP_012027675.1.91865 WP_012027675.1.91912 WP_012027675.1.91973 WP_012027675.1.91983 WP_012027675.1.92134 WP_012027675.1.92263 WP_012027675.1.92441 WP_012027675.1.92554 WP_012027675.1.92692 WP_012027675.1.92722 WP_012027675.1.928 WP_012027675.1.93190 WP_012027675.1.93456 WP_012027675.1.93519 WP_012027675.1.9361 WP_012027675.1.93627 WP_012027675.1.93646 WP_012027675.1.9376 WP_012027675.1.93771 WP_012027675.1.94332 WP_012027675.1.94338 WP_012027675.1.94418 WP_012027675.1.94419 WP_012027675.1.94449 WP_012027675.1.9454 WP_012027675.1.94639 WP_012027675.1.94780 WP_012027675.1.94786 WP_012027675.1.94945 WP_012027675.1.95180 WP_012027675.1.95213 WP_012027675.1.95214 WP_012027675.1.95262 WP_012027675.1.95288 WP_012027675.1.95351 WP_012027675.1.95542 WP_012027675.1.95798 WP_012027675.1.96164 WP_012027675.1.96282 WP_012027675.1.96451 WP_012027675.1.9652 WP_012027675.1.96524 WP_012027675.1.96574 WP_012027675.1.96700 WP_012027675.1.96973 WP_012027675.1.97052 WP_012027675.1.97453 WP_012027675.1.97493 WP_012027675.1.97504 WP_012027675.1.97506 WP_012027675.1.97515 WP_012027675.1.97554 WP_012027675.1.97857 WP_012027675.1.9809 WP_012027675.1.9815 WP_012027675.1.98253 WP_012027675.1.98271 WP_012027675.1.98326 WP_012027675.1.98343 WP_012027675.1.98406 WP_012027675.1.98416 WP_012027675.1.98464 WP_012027675.1.98860 WP_012027675.1.98864 WP_012027675.1.98921 WP_012027675.1.99127 WP_012027675.1.9922 WP_012027675.1.99252 WP_012027675.1.99324 WP_012027675.1.9956 WP_012027675.1.99696 WP_012027675.1.99988 YP_003029344.1.79686 218494.SSU1573 391295.SSU05_1767 391296.SSU98_1778 568813.SSUSC84_1599 568814.SSUBM407_1647 gi|556589398|ref|YP_008756952.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]