SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257125051|ref|YP_003163165.1| from Leptotrichia buccalis C-1013-b

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257125051|ref|YP_003163165.1|
Domain Number 1 Region: 83-177
Classification Level Classification E-value
Superfamily Ribosomal protein L6 2.22e-36
Family Ribosomal protein L6 0.00004
Further Details:      
 
Domain Number 2 Region: 1-82
Classification Level Classification E-value
Superfamily Ribosomal protein L6 2.62e-26
Family Ribosomal protein L6 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|257125051|ref|YP_003163165.1|
Sequence length 177
Comment 50S ribosomal protein L6 [Leptotrichia buccalis C-1013-b]
Sequence
MSRIGKKPITIPAGVEIKQEGNTFTVKGPKGQLVRELSSEIKVNIDGSEITIERPNDLPN
IRALHGTTRANLNNMIVGVSEGFTRGLELVGVGYRVQASGKGLTLSLGYSHPVEVEAVEG
ITFKVEGNTKISVEGIDKQLVGQVAANIRAKRPPEPYKGKGVKYADEVIRRKEGKKG
Download sequence
Identical sequences C7NDL2
523794.Lebu_0254 gi|257125051|ref|YP_003163165.1| WP_012806362.1.20655

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]