SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|257125072|ref|YP_003163186.1| from Leptotrichia buccalis C-1013-b

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|257125072|ref|YP_003163186.1|
Domain Number - Region: 54-100
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0379
Family NfeD domain-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|257125072|ref|YP_003163186.1|
Sequence length 136
Comment hypothetical protein Lebu_0275 [Leptotrichia buccalis C-1013-b]
Sequence
MKQNYLGTYGVLKGSYMESRLKYYDFESKQKVYGDPTSTILKCAKDDENEEYILVELLTT
NEKMRIKREGYELTSKPKFDIGDKVKLIKYPDKKATVRKIYWHDKDKRIYYLLNVENNKR
KSASRYYEDDNKLEKV
Download sequence
Identical sequences C7NDN3
523794.Lebu_0275 gi|257125072|ref|YP_003163186.1| WP_012806381.1.20655

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]