SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257125521|ref|YP_003163635.1| from Leptotrichia buccalis C-1013-b

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257125521|ref|YP_003163635.1|
Domain Number 1 Region: 18-230
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 1.09e-53
Family PP-loop ATPase 0.00012
Further Details:      
 
Domain Number 2 Region: 390-441
Classification Level Classification E-value
Superfamily PheT/TilS domain 0.0000000000144
Family tRNA-Ile-lysidine synthetase, TilS, C-terminal domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|257125521|ref|YP_003163635.1|
Sequence length 497
Comment tRNA(Ile)-lysidine synthetase [Leptotrichia buccalis C-1013-b]
Sequence
MEKEKIKKIKKKILEKSKKIIENNLISENDKILIAFSGGPDSVFLYYFLKFFKKKLEIEV
SIVYINHNLRSDVENDLQFVKKFAAENNIDYYIESINVNKYAKEKKKSVELAARELRYEA
IENIRKMINYDKIATGHNLDDNVETFIFRLLRGTSLSGLRSIPKVRENIIRPILEFEKSE
ILDFLKNENQDYIIDYTNNENNYTRNFIRNKIFPDFDKINPSFRKKIYMLIGEINDRDFE
NIKFSDQNAKILEKKEILKQNGIIRKDNIALFLKKNNIEVSREKINQIFKSFFDENDNLK
TEGSTALYLGKNKILKNEYGKLEITQENFRKKEWNLKNGKINNSFEKSQILKENQSIEWY
NYKIMFYKNIKNLKNHFAEDKNIDYTFFRFTDNIKNKKVIVRNRKDGDRILIKNLGHKKI
KKILIDEKIAKWERDFIPIIEAEIIENKYKDQSMKEKIILAVSDIKFSKFLEKINKNDIK
TLESNSEILIIGRKNGR
Download sequence
Identical sequences C7N913
WP_015768992.1.20655 523794.Lebu_0736 gi|257125521|ref|YP_003163635.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]