SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|257125641|ref|YP_003163755.1| from Leptotrichia buccalis C-1013-b

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257125641|ref|YP_003163755.1|
Domain Number 1 Region: 1-79
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.000000000161
Family RecO N-terminal domain-like 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|257125641|ref|YP_003163755.1|
Sequence length 231
Comment DNA repair protein RecO [Leptotrichia buccalis C-1013-b]
Sequence
MKIIKTNCIILKKKEMREADLQVTLFSKEYGKIMATAYGIRKSKKRNIVSLNPLNKVEIT
LLEKNGYYVIKDVEIMKNFKNIPKSIEKLEISLYILDSIDKIYYMTDENGNFFDKLVEIL
SFIDILPYIKKGYKYYVVLSFLRRIMIEHGIYDIEEIISILIKEKKENKKKYKEIMTILK
TNSDISEIQEKLESYTVFFKKMVIIFENFINKNLQVELKMKKFIMEEFYGN
Download sequence
Identical sequences C7N9D3
523794.Lebu_0856 WP_015769112.1.20655 gi|257125641|ref|YP_003163755.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]