SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257126215|ref|YP_003164329.1| from Leptotrichia buccalis C-1013-b

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257126215|ref|YP_003164329.1|
Domain Number 1 Region: 11-388
Classification Level Classification E-value
Superfamily Homocysteine S-methyltransferase 5.89e-102
Family Homocysteine S-methyltransferase 0.0000083
Further Details:      
 
Domain Number 2 Region: 346-611
Classification Level Classification E-value
Superfamily Dihydropteroate synthetase-like 1.15e-72
Family Methyltetrahydrofolate-utiluzing methyltransferases 0.00082
Further Details:      
 
Domain Number 3 Region: 906-1169
Classification Level Classification E-value
Superfamily Methionine synthase activation domain-like 2.49e-61
Family Methionine synthase SAM-binding domain 0.00044
Further Details:      
 
Domain Number 4 Region: 718-861
Classification Level Classification E-value
Superfamily Cobalamin (vitamin B12)-binding domain 2.88e-36
Family Cobalamin (vitamin B12)-binding domain 0.0000536
Further Details:      
 
Domain Number 5 Region: 632-715
Classification Level Classification E-value
Superfamily Methionine synthase domain 3.4e-20
Family Methionine synthase domain 0.00071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|257126215|ref|YP_003164329.1|
Sequence length 1169
Comment methionine synthase [Leptotrichia buccalis C-1013-b]
Sequence
MQKNLYKNSYNLLQNDLKNKILLLDGAMGTMIQQENLTADDFGGEKYEGCNDYLVLQRPD
VIKNIHKKYLEAGSDIIETNSFGALDIVLKDYDLEDTVFEMNKKAAELVNEAIAEYRSEH
PEVTRNLYVAGALGPSNKSISVTGGVTFEELIHTYYTAVSGLMAGGVDLILFETIQDTRN
LKAAYLGLKKAMEENYTVPLMLSFTIESTGTTLAGQTADAFYYAVNHMNPFSVGLNCATG
PEFMTQFLKTLNNISNTYISVYPNAGLPNEDGEYEETPDTLSAKIEPFFQNNYLNIVGGC
CGTTPEHIQKIKEKSINYSPRVIDENKDFNDVSGLITLETPKDRPIYVGERTNVIGSRIF
KNLIASEKFDEATEVARLQIKGRADVIDICLANPDRDEIADMKAFLDKVAKFAKVPLMID
STDINVVKEGLTYLQGKGIINSINLEDGEKKFTDMAKVIKDFGASVVVGLIDEEGMAVSV
ERKLEIARRSYELLTKKYGIDERDIIFDTLVFPVATGDQKYIGSATATIEAIRQIKDEMP
NVKTILGVSNISFGLPIAGREVLNTYYMQKAYEAGLDYAIVNTEKVIPMSEISDEEKELS
ENILFHTDDENVSKFANFYREKKAIQKVVDTSNMTMEERVANLVVEGSKKDLKICLDELL
KKYSPIEIINGPLMDGMDEVGRLFNNNDLIVAEVLQSAEVMKASVSHLEQFMEKDESSVK
GTVIMATVKGDVHDIGKNLVGIIIGNNGYKVIDLGINTPAEKIREAIIEHKADFLGLSGL
LVKSATEMVNTMEVLHEAGIDIPIFVGGAALTEKFTVNKIEPAYKNNIVIYSRDAMTALA
DLNKMIDEIKFREFKEYLQKRRELVTIKDAKKLEQLKVKPTVSDIKDADGTFDFSKVELP
KYDFEKIYKPQTLNKQIITNIKAKDVFPFINLQMLIGKHLGMKWIVNNLIEKQDPRTIKL
YNEILDIIENGDEYFDIKAIYKFFPVRRKAGEKKEDFKIEVLSDDLSTVLETFDFPRQKY
GQYLSLNDYVNPDGIDYIGFFVATAGEKSRLVSNELKEKGEFYRGHIVNSVGLELAEAAS
EYIHKMMRQDVGIIDKDISLNEILNAQYQGNRYSFGYPACPDLSDQRKLFNLLKPERYGI
SLTEEFMMYPEATVSAIVFSQPFCKYFNM
Download sequence
Identical sequences C7NB07
523794.Lebu_1463 WP_015769679.1.20655 gi|257126215|ref|YP_003164329.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]