SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257126920|ref|YP_003165034.1| from Leptotrichia buccalis C-1013-b

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257126920|ref|YP_003165034.1|
Domain Number 1 Region: 44-104
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.000000654
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.01
Further Details:      
 
Domain Number 2 Region: 179-240
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0000445
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.013
Further Details:      
 
Weak hits

Sequence:  gi|257126920|ref|YP_003165034.1|
Domain Number - Region: 108-168
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00085
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|257126920|ref|YP_003165034.1|
Sequence length 316
Comment protein PASTA domain-containing protein [Leptotrichia buccalis C-1013-b]
Sequence
MATKYKFNYGKFFRTIIVLLCLVTLAIFGKDVFERHFFNTRLTVIPNVVNLDKKDAIKYL
KEAGLKVKVINSKTEKVPLDTVYNQDPRPGKEVKVNRVIRIWVNNGEDVKVPNIVGLELL
EARSRLKGQNIQIETIDYFPSNQKYNTILGVYPKPGTKLEVNQKISILVSSQQMIDPSVM
PNITGLDVNDARELLKQIGLEIGSVSQTSDPTLPVNTIISTNPAAGTKIQRGQKVSVVVN
SGAAVRKRERSTEEIIKRSQQNINEREIERTIDDTINQIDRQNSNPGNSQQQGGERRNND
DTSTSPPGDSNADDDE
Download sequence
Identical sequences C7NDS9
WP_015770377.1.20655 523794.Lebu_2190 gi|257126920|ref|YP_003165034.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]