SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257125444|ref|YP_003163558.1| from Leptotrichia buccalis C-1013-b

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257125444|ref|YP_003163558.1|
Domain Number 1 Region: 117-335,372-520
Classification Level Classification E-value
Superfamily PLP-dependent transferases 4.3e-48
Family AAT-like 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|257125444|ref|YP_003163558.1|
Sequence length 532
Comment aspartate aminotransferase [Leptotrichia buccalis C-1013-b]
Sequence
MITKSFERKLEKLGAFEISFDMLKLSEKNEKHLKFLNAGRGNPNWINTLGRLAFARLMEF
GVSECKRTLDKGDLAGYVDSNGIEERYNAFLNRDDEVDVFLKKIVEYSVDHLDLDKKSLI
LELTNGIIGNNYPVPSRCLENTEHIINAFLQSILYGKANLRKNTKVFPVEGGTAAIVYIF
DSLKHNGLLNEGDRIAINTPVFTPYIQIPRLSNFDLAEVDLQAREENQWHIPDSEFEKLL
DPSVKAFFLVNPSNPGSRSLTDENLEQLRKVVVKRPDLIIITDDVYGTFVNGFRTVYSVC
PRNTILVYSYSKLYGVTGWRLGVIAINEDNVFDELIKKLPEKKKKELESDYSIVTFNPSE
MGFVERICADSRSIGLYHTSGLSTPQQIMMVLFSMTHLVLENEKDQYIEACKEIIAIRYH
NLMSTLGLPEDNSDSNAKYYTLIDIYQLAETNYDKNFATWLRNEFEEIDFLLHLAKEDGV
VLMEGVGFGATPGTVRISEANLEDNDYKKIANRIISLLKEYYEKYTKEKKKL
Download sequence
Identical sequences C7N8T6
gi|257125444|ref|YP_003163558.1| WP_015768915.1.20655 523794.Lebu_0659

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]