SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257126969|ref|YP_003165083.1| from Leptotrichia buccalis C-1013-b

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257126969|ref|YP_003165083.1|
Domain Number 1 Region: 223-609
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 1.26e-89
Family beta-Lactamase/D-ala carboxypeptidase 0.0000594
Further Details:      
 
Domain Number 2 Region: 86-246
Classification Level Classification E-value
Superfamily Penicillin binding protein dimerisation domain 4.19e-23
Family Penicillin binding protein dimerisation domain 0.0034
Further Details:      
 
Domain Number 3 Region: 646-699
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0000157
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|257126969|ref|YP_003165083.1|
Sequence length 700
Comment peptidoglycan glycosyltransferase [Leptotrichia buccalis C-1013-b]
Sequence
MKKGNKKNSIVDRAKSNIVKNRKKNINRLNKIYDFLNTFEGRFTIIVFFTIIGFIVITAN
LYKIQIIQGNKWRAAGEEKYSSKNYIKAKRGKISTTDGQVLAYDNEDFIVTLDPTLIEED
NIDSVLNMLKRYIEPLEVENYKNEYLKSKKAKKQYLKIKHKISYSTKIAIEEQIDNDRKD
AKIKGKKYKRKYKGVAFETSFTRNYVQNDAFQETLGFVNNENQGVYGIEKFYNKQLAGES
GIIKGLRIPEAFLSIINIKNKENSSSGKDGNNLVLTLDSIMQYTLDEELKQTFEKYSADS
AMGILMEVETGKILAMSSYPKSEDKANIKNRAITDYFEPGSIFKPITVSMGLQTKVINEN
SRISSSGSIRVQDRTIRDHSSLTIGNLNLTDIVAYSGNVAMVKISQMIDKNTFHKYLTDI
GLGAKSGIDTYFESTKELPKLRDLTEVRKATISFGQGISMTQIQMLVALNTVVNNGKLMK
PYLVDRIEDSNGKIVEQNKPIIIKKIFSDEISRLVRRYMEAVVNYGTGKNAYISGYRVAG
KTGTAQKSAVGGYTKGKYFSSFFAFFPADKPKYAMLITVNEPKGNYYGADVALPSVRHVL
EKLIDYRKIETNGRIKKNTDDKKSDVVKEEKKKDLTKIKQDFDKNIMPDLTGISLREFLS
IYPQGKFSQYEVKGSGKVIGQFPEKGIKLDKQSKIQIVLE
Download sequence
Identical sequences C7NDX8
523794.Lebu_2241 WP_015770426.1.20655 gi|257126969|ref|YP_003165083.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]