SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|226939539|ref|YP_002794612.1| from Laribacter hongkongensis HLHK9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|226939539|ref|YP_002794612.1|
Domain Number 1 Region: 120-277
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 9.03e-44
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00051
Further Details:      
 
Domain Number 2 Region: 408-546
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 1.07e-36
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.001
Further Details:      
 
Domain Number 3 Region: 1-125
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 7.85e-28
Family Duplicated SiR/NiR-like domains 1 and 3 0.0043
Further Details:      
 
Domain Number 4 Region: 252-276,314-420
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 6.21e-21
Family Duplicated SiR/NiR-like domains 1 and 3 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|226939539|ref|YP_002794612.1|
Sequence length 550
Comment CysI [Laribacter hongkongensis HLHK9]
Sequence
MYRYTEFDRQIVRERVAQFRDQTRRYLAGELSEDDFRPLRLQNGLYVQRHAPMLRIAIPY
GTLSSVQLRALAAISREFDRGWGHFTTRQNLQLNWVRLEEVPDILARLADVDMHAIQTSG
NCIRNTTTDHFAGVAADEVADPRPWCELIRQWSTLHPEFAYLPRKFKIAVSASETDRAAT
WFHDIGIQLVRNAAGELGCRIIAGGGLGRTPMRGEVIHEFVESGHLLTYLEAVLRIYNRY
GRRDNKYKARIKILLKAMTPAGFAARVEDEWRHTREGAARVSPQVLAGLAGQFAVPDYDV
READAGLAVQMSDDPAFARWVRRNTTPHRQAGWRAVTLSLKPHGAPPGDATAEQMEAVAG
WADRFGFGEIRVSHEQNLILPDVRERDLHVLWQLARAERLTTSNIGLLTDAICCPGGDYC
GLANARSIPVIEAISTRLDDLDYLEDLGEIDLNLSGCMNACGHHHVGHIGILGVDKNGEE
WFQVTLGGDAADGLLGRVIGPSFARAEMADVVEKLLLTYVELREAGERFIDTVSRTGIAP
FKERVYAKID
Download sequence
Identical sequences C1DCW8
557598.LHK_00610 WP_012696095.1.72885 gi|226939539|ref|YP_002794612.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]