SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|226941068|ref|YP_002796142.1| from Laribacter hongkongensis HLHK9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|226941068|ref|YP_002796142.1|
Domain Number 1 Region: 3-206
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.63e-57
Family G proteins 0.00025
Further Details:      
 
Domain Number 2 Region: 151-300
Classification Level Classification E-value
Superfamily Translation proteins 1.48e-31
Family Elongation factors 0.0053
Further Details:      
 
Domain Number 3 Region: 399-513
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 2.3e-31
Family EF-G/eEF-2 domains III and V 0.012
Further Details:      
 
Domain Number 4 Region: 303-388
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 0.0000000000000165
Family EF-G/eEF-2 domains III and V 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|226941068|ref|YP_002796142.1|
Sequence length 605
Comment TypA [Laribacter hongkongensis HLHK9]
Sequence
MSRNLRNIAIIAHVDHGKTTLVDKLLHQAGTFRDNQHIAERVMDSNDLERERGITILAKN
TAVNYNGTHINIVDTPGHADFGGEVERVLGMVDGVVLLVDAQEGPMPQTRFVTKKALALG
LKPIVVINKIDRPGARPDWVVDQTFDLFDKLGATDEQLDFPVVYASGLNGFAKMELDEES
DDMRPLFETIVRHVEPPKGSPDEPLQLQISALDYSTYTGRIGVGRVARGRIRPGQQVVVM
AGVDGQPKAAKVNQVLGFQGLERVQVEEAEAGDIILINGIEDIGIGVTICERDNPEALPM
LSVDEPTLTMNFQVNNSPLAGTEGKFVTSRQLRDRLQKELLTNVALRVEDTGDADVFLVS
GRGELHLTILLENMRREGYELSVSKPRVVIKEIDGEKCEPYEMLTVDVEDDNQGAVMEEL
GRRRGELQDMVSDGKGRTRLEYRIPARGLIGFQGEFLTMTRGTGIMAHVFDEYAPMKPDM
PGRRNGVLISQENGDAVAYALWNLEDRGRMFVSPGEKLYEGMIIGIHSRENDLVVNPIKG
KKLTNVRASGTDEAVRLTPPIRLTLEYAVEFIDDDELVEITPQSIRVRKRHLNEHDRKKA
LRGLL
Download sequence
Identical sequences A0A248LKJ7 C1D9N1
557598.LHK_02149 gi|226941068|ref|YP_002796142.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]