SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|226939556|ref|YP_002794629.1| from Laribacter hongkongensis HLHK9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|226939556|ref|YP_002794629.1|
Domain Number 1 Region: 16-100
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000137
Family Anti-sigma factor antagonist SpoIIaa 0.016
Further Details:      
 
Weak hits

Sequence:  gi|226939556|ref|YP_002794629.1|
Domain Number - Region: 179-247
Classification Level Classification E-value
Superfamily DmpA/ArgJ-like 0.0549
Family DmpA-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|226939556|ref|YP_002794629.1|
Sequence length 371
Comment ABC transport system permease protein [Laribacter hongkongensis HLHK9]
Sequence
MTASSQARLVCTPGRLRLEGPLTTHSVGSIWAEALAALAAQPQTPLTLDASAVTQLDSAG
LVLLHRLLHDPRPASAPVALSGLAAEYQPLLERIRTASLTPPASPPPLSPVERIGAATLS
GLHTGRDSVVWTGASASALWRALCRPARLEGARVLDIMASAGTQALPIVLLIGFLMGTIL
AFQMGLVAQGFGAGLLVVNGIGIAMLRELGPLMTAIVFAGRSGAAFAAELGTQKVNEEIY
ALHTFGIDPVAFLVLPRLVAAVLVLPLLTVLADVIGLLGGALVMQAFSVTPMQFYHQTLA
TVSLTDLYFGLGKSMVFGLFIAQIGCRQGLSAGQGPTAVGVAATRAVVSSLIWIVVIDGL
FAALLGQWQST
Download sequence
Identical sequences C1DCY5
gi|226939556|ref|YP_002794629.1| WP_012696112.1.1877 WP_012696112.1.72885 557598.LHK_00627

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]