SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|238918088|ref|YP_002931602.1| from Edwardsiella ictaluri 93-146

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|238918088|ref|YP_002931602.1|
Domain Number 1 Region: 1-105
Classification Level Classification E-value
Superfamily Frataxin/Nqo15-like 2.62e-39
Family Frataxin-like 0.0000164
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|238918088|ref|YP_002931602.1|
Sequence length 107
Comment iron donor protein CyaY, putative [Edwardsiella ictaluri 93-146]
Sequence
MNDSEFHLLADGLMQALEEALDACQSDADIDCETNGGVMTLSFENGSKIVINRQEPLHQI
WLATRAGGYHFDYRNGQWRCSRSGVPLPQVLNEACSAQAGIPVTLDL
Download sequence
Identical sequences C5BBD2
634503.NT01EI_0112 gi|238918088|ref|YP_002931602.1| WP_015869586.1.60554 WP_015869586.1.7078 WP_015869586.1.9917

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]