SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|417359043|ref|YP_002932903.2| from Edwardsiella ictaluri 93-146

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|417359043|ref|YP_002932903.2|
Domain Number 1 Region: 179-391
Classification Level Classification E-value
Superfamily Restriction endonuclease-like 8.04e-71
Family Type II restriction endonuclease catalytic domain 0.0000000811
Further Details:      
 
Domain Number 2 Region: 3-173
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.67e-50
Family Type II restriction endonuclease effector domain 0.00000179
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|417359043|ref|YP_002932903.2|
Sequence length 399
Comment type II restriction endonuclease [Edwardsiella ictaluri 93-146]
Sequence
MSDLSSWIIDKLTGNAYVYIKRLSANDTGATGAHQVGTYMQHSAAEYLFPSINKTDECNP
SLMITARTSSHSYPENQVRVIYYNNKFFGKTRNERRITRWGGGSPLQDTENTGALALLVF
DSSLGGKSDCQSVDVWVCRDADEEDIVEASIGEILPGDLIFGLADEVFGGFFAKRTSSHK
YTFPDEWKKYFPSGKEIISYASGYYSKHNLSPDTQLLERRKIEYDIFLQVEELHVLSVIK
TGFSSVDAFISLANSVSNRRKSRSGKSLELHLENIFYEYGLTEFETQAVTEGNKKPDFLF
PSAKAYHDDSWPPQKLRMLAVKTTCKDRWRQILNEADRIQDIYLFTLQEGVSITQFREMQ
EERVRLVVPEKLHEKYPAEIRGNLISLNDFIFDTKKLYS
Download sequence
Identical sequences C5BFF1
WP_015870831.1.60554 WP_015870831.1.9917 gi|417359043|ref|YP_002932903.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]