SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|238918126|ref|YP_002931640.1| from Edwardsiella ictaluri 93-146

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|238918126|ref|YP_002931640.1|
Domain Number 1 Region: 3-322
Classification Level Classification E-value
Superfamily FMN-binding split barrel 1.1e-124
Family UbiD middle domain-like 0.000000000059
Further Details:      
 
Domain Number 2 Region: 323-485
Classification Level Classification E-value
Superfamily UbiD C-terminal domain-like 1.31e-67
Family UbiD C-terminal domain-like 0.0000000423
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|238918126|ref|YP_002931640.1|
Sequence length 495
Comment 3-octaprenyl-4-hydroxybenzoate carboxy-lyase [Edwardsiella ictaluri 93-146]
Sequence
MKYRDLREFIALLEQRGELKRIQQSIDPYLEMTEIADRTLRVGGPALLFENPKGYDIPVL
CNLFGTPQRVALGMGQEEVGALRDVGKLLAFLKEPDPPKGFRDLVEKLPQFKQILNMPTK
RLSKAPCQEQVLQGDDVDLATLPVMHCWPQDVAPLVSWGLTVTRGPCKSRQNLGIYRQQV
LGKNKLIMRWLSHRGGALDFQDWCQAHPGERFPVAVALGADPATLLAAVTPVPDSLSEYA
FAGLLRGHKSEVVKCLSCDLEVPASAEIVLEGYIEPGETAPEGPYGDHTGYYNEVERFPV
FTVTHLTQRDRPIYHSTYTGRPPDEPAVLGLALNEVFVPLLQKQFPEIVDFYLPPEGCSY
RMAVVTMKKQYPGHAKRVMMGVWSFLRQFMYTKFVIVCDDDINARDWQDVIWALTTRMDP
ARDTLLIENTPIDYLDFASPVSGLGSKMGLDATNKWPGETQREWGHPIVMDEAVRARVDT
LWNELDIFANDKDAQ
Download sequence
Identical sequences C5BCB4
634503.NT01EI_0150 WP_015869621.1.60554 WP_015869621.1.7078 WP_015869621.1.9917 gi|238918126|ref|YP_002931640.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]