SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|237802943|ref|YP_002888137.1| from Chlamydia trachomatis B/Jali20/OT

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|237802943|ref|YP_002888137.1|
Domain Number 1 Region: 84-177
Classification Level Classification E-value
Superfamily Ribosomal protein L6 2.36e-33
Family Ribosomal protein L6 0.000061
Further Details:      
 
Domain Number 2 Region: 1-83
Classification Level Classification E-value
Superfamily Ribosomal protein L6 7.07e-18
Family Ribosomal protein L6 0.00075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|237802943|ref|YP_002888137.1|
Sequence length 183
Comment 50S ribosomal protein L6 [Chlamydia trachomatis B/Jali20/OT]
Sequence
MSRKARDPIVLPQGVEVSIQNDEISVKGPKGSLTQVLAKEVEIAVKGNEVFVTPAAHVVD
RPGRIQGLYWALIANMVKGVDTGFEKRLEMIGVGFRAAVQGSLLDLSIGVSHPTKMPIPT
GLEVSVEKNTLISIKGINKQLVGEFAACVRAKRPPEPYKGKGIRYENEYVRRKAGKAAKT
GKK
Download sequence
Identical sequences 580049.JALI_5171 gi|237802943|ref|YP_002888137.1| WP_012727934.1.92427

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]