SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257783857|ref|YP_003179074.1| from Atopobium parvulum DSM 20469

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257783857|ref|YP_003179074.1|
Domain Number 1 Region: 96-208
Classification Level Classification E-value
Superfamily Probable bacterial effector-binding domain 0.000000471
Family Gyrase inhibitory protein GyrI (SbmC, YeeB) 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|257783857|ref|YP_003179074.1|
Sequence length 210
Comment hypothetical protein Apar_0046 [Atopobium parvulum DSM 20469]
Sequence
MAFDFKKEFKELYAPKNKPSIVKVPRINYLAVRGFGDPNVEDGEYKQSIGLLYGVAYAIK
MSKKSTHHIEGYFDFVVPPLEGFWWQEDTQGVDYAHKENFKWISVIRLPDFVTKEDFDWS
VAEATKKKKLDFSKVEFFTYDEGLCVQCMHIGPYNSEPETVSLMHEYMESQGYVLDITAE
RMHHEVYLSDVRKIAPEKLKTVIRHPIREV
Download sequence
Identical sequences C8W8P5
WP_012808143.1.33702 521095.Apar_0046 gi|257783857|ref|YP_003179074.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]