SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257784130|ref|YP_003179347.1| from Atopobium parvulum DSM 20469

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257784130|ref|YP_003179347.1|
Domain Number 1 Region: 1-146
Classification Level Classification E-value
Superfamily Phoshotransferase/anion transport protein 3.66e-30
Family IIA domain of mannitol-specific and ntr phosphotransferase EII 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|257784130|ref|YP_003179347.1|
Sequence length 152
Comment putative PTS IIA-like nitrogen-regulatory protein PtsN [Atopobium parvulum DSM 20469]
Sequence
MLLRDIYEQNHYAFVKTPMTWEESIRECCKPLEADGTVNPEYADDIIECIKKYGPYIVIV
PNVAMPHSTARIGSNGKTAIGFMHSDVPVNFEDGDEEKQVKTFFTLSATDQEAHLKNMQM
LVQVLMNQEVLERLKNIQSPEELLEIDKLISE
Download sequence
Identical sequences C8W9G8
gi|257784130|ref|YP_003179347.1| WP_012808414.1.33702 521095.Apar_0325

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]