SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257784132|ref|YP_003179349.1| from Atopobium parvulum DSM 20469

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257784132|ref|YP_003179349.1|
Domain Number 1 Region: 4-93
Classification Level Classification E-value
Superfamily PTS system IIB component-like 0.00000000000000602
Family PTS system, Lactose/Cellobiose specific IIB subunit 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|257784132|ref|YP_003179349.1|
Sequence length 102
Comment PTS system lactose/cellobiose-specific transporter subunit IIB [Atopobium parvulum DSM 20469]
Sequence
MNAKILVACANGAGTSLMMKMTAERVTQKLNMGVDKIHHCALSEGVSSARQYDIVFAPLN
FLNMYDDAAKAGVTVIGLRNVLSDAEMEEKLKETGAAEKFSA
Download sequence
Identical sequences C8W9H0
521095.Apar_0327 WP_012808416.1.33702 gi|257784132|ref|YP_003179349.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]