SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257784209|ref|YP_003179426.1| from Atopobium parvulum DSM 20469

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257784209|ref|YP_003179426.1|
Domain Number 1 Region: 40-124
Classification Level Classification E-value
Superfamily TrpR-like 5.13e-21
Family SPO1678-like 0.015
Further Details:      
 
Weak hits

Sequence:  gi|257784209|ref|YP_003179426.1|
Domain Number - Region: 6-55
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0119
Family Homeodomain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|257784209|ref|YP_003179426.1|
Sequence length 165
Comment hypothetical protein Apar_0404 [Atopobium parvulum DSM 20469]
Sequence
MRMDRRVKHDIEVRKKAAELFDAGMGSRAVASTLSVPLPTVKVWQHIYHAFGSEVLLTMD
GKQAKYTYEQKVAAARAVIEGGMTKTEAMAKFKIMSLAPLERWCRLYRTGGAEALKPKPK
GRPKGSKSKPQKRTREQELEERCLRLETEVAYLKKLRALVEKGEL
Download sequence
Identical sequences C8W9P7
WP_012808493.1.33702 521095.Apar_0404 gi|257784209|ref|YP_003179426.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]