SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257784591|ref|YP_003179808.1| from Atopobium parvulum DSM 20469

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257784591|ref|YP_003179808.1|
Domain Number 1 Region: 303-472
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.23e-46
Family Ribonuclease PH domain 1-like 0.00000616
Further Details:      
 
Domain Number 2 Region: 4-142
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.21e-40
Family Ribonuclease PH domain 1-like 0.0000267
Further Details:      
 
Domain Number 3 Region: 454-552
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 5.24e-27
Family Ribonuclease PH domain 2-like 0.00017
Further Details:      
 
Domain Number 4 Region: 136-227
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.31e-19
Family Ribonuclease PH domain 2-like 0.0038
Further Details:      
 
Domain Number 5 Region: 610-692
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.06e-18
Family Cold shock DNA-binding domain-like 0.00064
Further Details:      
 
Domain Number 6 Region: 556-632
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000091
Family Eukaryotic type KH-domain (KH-domain type I) 0.003
Further Details:      
 
Domain Number 7 Region: 249-330
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.000000000000119
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|257784591|ref|YP_003179808.1|
Sequence length 732
Comment Polyribonucleotide nucleotidyltransferase [Atopobium parvulum DSM 20469]
Sequence
MTKVTHEFDLYGKHYTLEAGELAKQATGACIVKCGDSTVLLTAVVSKERKDYDFFPLTVD
FIEKMYAVGRVPGGYLKREARPSEKATLTARMIDRPLRPSFPEGFRNEVQIVATSLVADQ
VNAVDTISVMGASAALAVGGVPFEGPLACVRIGRNADTGEFLVNPTYEERDHSDLDLELG
GSSTFISMLEAGADEISEEDMLSAMAFGQEAIAAFCEEQKKFIAKWEEVNGPIVKREYIL
DEPIAEVHDRIFAYYDQMSAALKDADKQSRMQKVADLMDEIKAQFTEEEQELWSRAIAVE
LKALEKHAMRVMVVETGERVDGRVANEIRPIMVKPDYLPLVHGSGLFQRGQTQVLSICTL
GMLNEWQRLDTIEPMDGKRYIHHYNFPPFCTGETGRMGSPKRREIGHGALAERALLPVIP
SEEEFPYTIRVVSEVMESNGSSSMASTCGSTLSLMDAGVPLKRPVSGVAMGLIQENGKTV
VLTDIQGLEDFLGDMDFKVCGTTKGITAMQMDNKATGLTPEILRNALMQAHEGRMFILNK
MLEQIPAPRTETKETAPQIISLSIPIDKIRDVIGSGGKVIRGIQEDTGATVDIQEDGTVF
IAGTNGAAEAAAERIKAIVKVPEVGEEYTGRVVGLQPFGAFVELLPGKDGLLHISRVAQG
RVEKIEDVLAIGDEVKVKVLEVDEKGKISLDRLDKPEAPQGASKKDREEHRSRRQNDTGS
SERRQPRRHHDA
Download sequence
Identical sequences C8W6X7
521095.Apar_0788 gi|257784591|ref|YP_003179808.1| WP_012808874.1.33702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]