SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257784655|ref|YP_003179872.1| from Atopobium parvulum DSM 20469

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257784655|ref|YP_003179872.1|
Domain Number 1 Region: 5-151
Classification Level Classification E-value
Superfamily RNase III domain-like 5.36e-40
Family RNase III catalytic domain-like 0.00048
Further Details:      
 
Domain Number 2 Region: 116-231
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 1.57e-24
Family Double-stranded RNA-binding domain (dsRBD) 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|257784655|ref|YP_003179872.1|
Sequence length 243
Comment ribonuclease III [Atopobium parvulum DSM 20469]
Sequence
MKLHERVAAAEAICGHTFINKDLIEAALTHPSAVEGKPVSASYERLEFLGDSILGAIIAT
ELFERYPDMDEGQLTRLKISLVSGHTLSIVSDTLGVSPLIVMGISEKGTGKRGMKSALEN
VYESIVGALYLDAGFEPTRDFVIRTLGPHISPTLAVRSVSPKSRLQEAVQAQGKATPEYK
LIGESGPAHTPTFTAVVFVDGLKVGRGQGPSKKAAESEAAQDALVRLGVDDAPLDADAEM
HLR
Download sequence
Identical sequences C8W741
WP_012808938.1.33702 gi|257784655|ref|YP_003179872.1| 521095.Apar_0852

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]