SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257785020|ref|YP_003180237.1| from Atopobium parvulum DSM 20469

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257785020|ref|YP_003180237.1|
Domain Number 1 Region: 14-381
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 8.3e-58
Family Pyruvate oxidase and decarboxylase PP module 0.054
Further Details:      
 
Domain Number 2 Region: 389-611
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 5.59e-20
Family TK-like Pyr module 0.06
Further Details:      
 
Domain Number 3 Region: 634-768
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 0.0000785
Family Transketolase C-terminal domain-like 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|257785020|ref|YP_003180237.1|
Sequence length 823
Comment putative phosphoketolase [Atopobium parvulum DSM 20469]
Sequence
MAQPVYGTPWQTLNQPVSEEELAGVDRYWRAANYLSVGQIYLRSNPLMKDGFSREDVKHR
LVGHWGTTPGLNFLFGHVNRFIRDHNQNTIFLMGPGHGGPAGTAQSLLDGTYRETYPFIT
DDEEGLQKFFRRFSYPGGIPSHYAPETPGSIHEGGELGYTLSHAYGAVLDNPSLLAVAVV
GDGEAETGPLATSWQTNKFMDPLTDGIVLPILHLNGYKIANPTILARISDGERDEFFRGM
GYHPYNFVAGFDDEDHASIHRRFAALLEAVFNEICAIKTRAAAGDASRPYYPMIIFRTPK
GWTCPPYIDGKKTEGSWRAHQVPLASARDTEAHFQVLRDWMSSYNPETLFTEKGAIRPEV
TSFMPKGDLRLGANPNANGGTIRRNLVLPDAKKYEIPVAEKGHGFGATEATRVLGEYTAE
LINSNRSEFRIFGPDETASNRLQPSFQVTDKQWFGGFNDDFENDEHISPVGNVIEQLSEH
QCEGLLEGYTLTGRHGIWSSYESFVHIIDSMINQHAKWLEATVRHIPWRKPISALNLVLS
SHVWRQDHNGFSHQDPGFVDIMLNKSFNNDHITNIYFPADANLLLAVGEKCYTSTNCINA
IFAGKQPAPTWVTLDEAREELSVGAKEWKWASNAEAGEEDIVLASCGDVPTQELLAALDM
LGKLGIKARFVNVVDLLKIQNASENNEALSDEEFTKLFSADKPVLFAFHAYAGSVRRLIW
NRPNHDNFNVHGYEEQGSTTTPYDMLRLNNMDRWALAADALRMIDAQKWADQIDEWEKFR
TEAFEFAVEKGYDHPAFTDWSWPDASDADQSISATQATAGDNE
Download sequence
Identical sequences C8W856
WP_012809302.1.33702 gi|257785020|ref|YP_003180237.1| 521095.Apar_1219

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]