SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Babin1|6166|gm1.999_g from Babjeviella inositovora NRRL Y-12698 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Babin1|6166|gm1.999_g
Domain Number 1 Region: 49-164
Classification Level Classification E-value
Superfamily Frataxin/Nqo15-like 3.49e-34
Family Frataxin-like 0.0000525
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Babin1|6166|gm1.999_g
Sequence length 170
Sequence
MLRSTIRLGLQTSRAIAPLAARSTLPTGPTVSLSARFTRSYAAPKQVTTDGHDITTNIDE
ITINQYHKLADVYLESFVDEVEALGEQYPEIDIELTQGVMTFALPPNGVYVINKQPPNKQ
IWLSSPISGPKRYDLVKGQWTSLRDNSLLTNLMAAEIASALKIDFKFEAI
Download sequence
Identical sequences A0A1E3QUX9
jgi|Babin1|6166|gm1.999_g XP_018986796.1.12885

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]