SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|338211536|ref|YP_004655589.1| from Runella slithyformis DSM 19594

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|338211536|ref|YP_004655589.1|
Domain Number 1 Region: 296-522
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.09e-39
Family ABC transporter ATPase domain-like 0.00018
Further Details:      
 
Domain Number 2 Region: 87-292
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 1.83e-18
Family DNA repair protein MutS, domain III 0.0096
Further Details:      
 
Domain Number 3 Region: 727-802
Classification Level Classification E-value
Superfamily SMR domain-like 0.0000000458
Family Smr domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|338211536|ref|YP_004655589.1|
Sequence length 803
Comment MutS2 protein [Runella slithyformis DSM 19594]
Sequence
MLYPQDLEQKLGFDRIREQLSELCLSPLGRAFVQKIRFSDNFAVIDKLTRQTAEMKAILE
ESTGEFPSQNYLDATPALDKMRVEGMVLSLEEFFDLKLSLRTIRQVLKFLADQEDGRFPF
LTELAGNVKVEKSVSDAIDRIIDDRGQIRDNASPELADIRRRLISEAAGVRKKLDSMLKH
AKSSGWVGDDVSLTVRNGRMVIPISAEHKRKLKGFVHDESSTGQTLFIEPADVLDANNEI
KELEYAERREINRILIQLANQIRRHLPDLQKACQFLGMVDFIRAKAKFASLLGAVNPAFV
NQPVIDWRVARHPLLYLSFQKQGRKVVPLSIDLRQNQRILVISGPNAGGKSVALKTIGLT
QYMLQCGLLVPMREDSTVGVFQNLFIDIGDEQSLDNDLSTYSSHLTNMRHFLQFAHKRTL
FLIDEFGTGTEPSLGGAVAEAILEDLTKSGAFGVINTHYTNLKTYADKTQGLVNGAMRYD
GEHLEPLYELEIGKPGSSFAFEIATKIGLPKAVIERAKGKLGTQQVNFEKLLKELDIEKK
VFSEKNIEIGIKERKLAQQLVETTALQTRLDNDQKKILNDAKQKAKQLLATANQRIESTI
REIKENKAERDTTKLVRQELEKFEKQELKIETVAEPEREEFIPEGGAIDVGSFVRIKGQP
TVGEVLAMKGKDIEIRIGDLKSNVKLNRLEKVSKKAFKEATGEKTSGPKTGVGGIDINEK
MMNFSFNLDIRGKRGEEAIVELDDFLSNALMLGFNELRIVHGKGDGILRQLVRNHLKSYK
QVGKMQDEHPDRGGAGVTIVQMR
Download sequence
Identical sequences F8ECY5
gi|338211536|ref|YP_004655589.1| WP_013927768.1.37789

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]