SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|338211921|ref|YP_004655974.1| from Runella slithyformis DSM 19594

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|338211921|ref|YP_004655974.1|
Domain Number 1 Region: 638-807
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 2.49e-47
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0023
Further Details:      
 
Domain Number 2 Region: 3-190
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 6.91e-44
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0033
Further Details:      
 
Domain Number 3 Region: 145-309
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.45e-26
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0077
Further Details:      
 
Domain Number 4 Region: 510-646
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 3.76e-25
Family Duplicated SiR/NiR-like domains 1 and 3 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|338211921|ref|YP_004655974.1|
Sequence length 839
Comment nitrite reductase (NAD(P)H) large subunit [Runella slithyformis DSM 19594]
Sequence
MAQPQKVVVVGNGMVGYKFCEKLLNKAGGGSFSITVIGEEPRPAYDRVHLSAYFSGTSVD
ELTMAPASWYADNGIQLLTGECVLHIHPEEHCVITHTGRRVDYDKLILATGSSAFVPPVP
GVEKEGVFVYRTIEDLDAIMSYAQKATRAAVIGGGLLGLEAAKATLDLGLETHVIEFAPR
LMPRQLDAAGAGMLKRKMEALGIHIHLHKNTAHFEGESCVKGLAFVDGSLLEVDMVVVSA
GIRPRDELAKLVGLGVGPRGGIMVNDELQTTNPDIYAIGECALHQGMIYGLAAPGYEMAE
VVAHNLASAFSENGITKSFRAFDMSTKLKLIGVDVASFGDPFCEHTPHDTIVVEDKLKGI
YKRLNVTTDGRHLLGGILVGEADNYNMLLQMVKNQLILPPNPEELVMPVRQGESTGTGMG
VASLPDDASICSCENITKGRICEAIASQNLGDMAAIKKCTKAGTGCGGCVPMLSDLLTET
LKKQGKTVKKVLCEHFDYSRQEMYHLIKMSGTRTFDEVLEKHGKGCGCETCKPAVASMLA
SIYNDVIAKQAVIQDTNDRYMANIQRGGTYSVVPRVPGGEITPDQLITLGIVAKKYDLYC
KITGGQRVDLFGARVEQLPFIWEELIEVGFESGHAYGKALRTVKSCVGNTWCRFGVQDAV
GYAVRIENRYKGIRAPHKLKSAVSGCTRECAEAQSKDFGIIATEKGWNLYLCGNGGIKPQ
HAVLFASDLDDDTCIKYIDRFLMFYIKTAEPLQRTATWFNKLEGGLDYLREVIINDSLGI
CSELEQEMEYLIETYHDEWRVAVETPEIRARFTHFVNSEEADPSLAFVEMRGQKRPADW
Download sequence
Identical sequences F8EE26
gi|338211921|ref|YP_004655974.1| WP_013928153.1.37789

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]